GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:26:29, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001005459            1377 bp    mRNA    linear   VRT 25-DEC-2019
DEFINITION  Xenopus tropicalis empty spiracles homeobox 1 (emx1), mRNA.
ACCESSION   NM_001005459
VERSION     NM_001005459.1
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
REFERENCE   1  (bases 1 to 1377)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev. Dyn. 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC074580.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC074580.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00028292, SAMD00028293
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1377
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8364"
                     /chromosome="1"
                     /map="1"
     gene            1..1377
                     /gene="emx1"
                     /note="empty spiracles homeobox 1"
                     /db_xref="GeneID:448058"
                     /db_xref="Xenbase:XB-GENE-920144"
     exon            1..558
                     /gene="emx1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    129..131
                     /gene="emx1"
                     /note="upstream in-frame stop codon"
     CDS             210..911
                     /gene="emx1"
                     /note="empty spiracles homeobox 1, gene 2; empty spiracles
                     homolog 1; empty spiracles-like protein 1"
                     /codon_start=1
                     /product="homeobox protein EMX1"
                     /protein_id="NP_001005459.1"
                     /db_xref="GeneID:448058"
                     /db_xref="Xenbase:XB-GENE-920144"
                     /translation="
MFQPAGKRCFTIESLVAKDNPLSSEEPLRPAALPYPGAPAEAFVSGFPSPAGRSLYNNPELVFPETVSHPPLTVHPHQLGASHLQHPHSFFAPQHRDPLNFYPWVLRNRFFGHRFQGGDVSQESLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKRQKLEEEGPDSDQKKKGSHHINRWRLATKQPNGEDIDVTSND"
     misc_feature    462..>791
                     /gene="emx1"
                     /note="Homeobox protein; Region: Abdominal-A; cl27820"
                     /db_xref="CDD:332641"
     misc_feature    order(615..629,633..635,684..686,702..704,741..743,
                     747..752,759..764,768..776,780..785)
                     /gene="emx1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(621..623,630..632,750..752,759..764,771..773)
                     /gene="emx1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    624..782
                     /gene="emx1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:306543"
     exon            559..743
                     /gene="emx1"
                     /inference="alignment:Splign:2.1.0"
     exon            744..1338
                     /gene="emx1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gagcggcaggtaacagcgagtggagcagtggagctctctcctctctctcctctctctctctctctttctggccaaggtggatggagttgggagccttctctggacactgagctgagtcctttccccagtagctggatacttctgttgggggctggggggctgcaattggctgtgagctcggtgggacacggttcggcccctcaggcaccatgttccagcctgcaggaaagcgctgcttcaccatcgaatcgctggtggcaaaggacaatcccctgagctccgaggagcccctgagaccggcggccctcccctaccctggggccccagcagaagcctttgtcagcggattccccagcccagccggacggtccctctataacaacccggagcttgtgttccctgagactgtcagccacccacccctgactgtgcacccccaccagctgggggcatctcacctacagcacccacactcattcttcgcaccccagcacagggaccctctcaacttctacccctgggtgctcaggaacaggttctttgggcacagatttcaaggcggcgacgtttcccaggagagtttgctcctacacggcccattcgccaggaaacccaaacggatcagaacggccttctccccgtctcagctgctcaggctggagagggcatttgagaagaaccattatgtggtgggggctgaacggaaacagttggccagcagcctcagtctgtctgagacccaggtgaaggtttggttccagaacagaaggacaaaatacaaaaggcagaagttggaagaggaaggtccagattctgatcagaagaaaaaaggttctcatcacatcaaccggtggcgattggccaccaaacagcccaatggggaagacattgatgttacctccaatgactagtagggtcacgtgtgcgagtcaatgtagggatcagactggaaacaaactcccaaggaactcactgataccgaatcggaacagtcttgctcagacgccaaggaggactattagagacctgctaacacctaggcccaagggcagcaggattaacccgcaggaggagcaacacgcgcacttgttctatgaaggacggaggtggactggtccacccaatggctgatctctctcatgaacttttgtcagccacaagccgtctatcagcaactggtcgaaacaaaatgtctcacctgtcctctgtctttttttcggcttttttttttccctttttgctaatttttaatttattttcttttcctaatataaaaaagtagctattaccaatttagtgcttaaatgtgtgttaataaatatcatatggatacatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]