GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:31:26, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_001003098             804 bp    mRNA    linear   MAM 23-JUN-2018
DEFINITION  Canis lupus familiaris msh homeobox 2 (MSX2), mRNA.
ACCESSION   NM_001003098
VERSION     NM_001003098.2
KEYWORDS    RefSeq.
SOURCE      Canis lupus familiaris (dog)
  ORGANISM  Canis lupus familiaris
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;
            Canis.
REFERENCE   1  (bases 1 to 804)
  AUTHORS   Haworth K, Breen M, Binns M, Hopkinson DA and Edwards YH.
  TITLE     The canine homeobox gene MSX2: sequence, chromosome assignment and
            genetic analysis in dogs of different breeds
  JOURNAL   Anim. Genet. 32 (1), 32-36 (2001)
   PUBMED   11419342
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AJ277753.1.
            On Jun 3, 2007 this sequence version replaced NM_001003098.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ277753.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103936001, SAMEA103936002
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..804
                     /organism="Canis lupus familiaris"
                     /mol_type="mRNA"
                     /sub_species="familiaris"
                     /db_xref="taxon:9615"
                     /chromosome="4"
                     /map="4"
     gene            1..804
                     /gene="MSX2"
                     /note="msh homeobox 2"
                     /db_xref="GeneID:403663"
                     /db_xref="VGNC:VGNC:43455"
     CDS             1..804
                     /gene="MSX2"
                     /function="transcription factor"
                     /note="muscle segmentation homologue (MSX2); homeobox
                     protein Hox-8; msh homeobox homolog 2; msh homeo box
                     homolog 2"
                     /codon_start=1
                     /product="homeobox protein MSX-2"
                     /protein_id="NP_001003098.1"
                     /db_xref="GeneID:403663"
                     /db_xref="VGNC:VGNC:43455"
                     /translation="
MASPSKGSDLFSSDEEGPAALAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKGASPRPADSASAGAALRPLLLPGHGAREAPSPGPPGKPFEAASVKSESAEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS"
     misc_feature    order(427..441,445..447,496..498,514..516,553..555,
                     559..564,571..576,580..588,592..597)
                     /gene="MSX2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    433..594
                     /gene="MSX2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:306543"
     misc_feature    order(433..435,442..444,562..564,571..576,583..585)
                     /gene="MSX2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..379
                     /gene="MSX2"
                     /inference="alignment:Splign:2.1.0"
     exon            380..804
                     /gene="MSX2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggcttctccgtccaaaggcagtgacctgttctcgtccgatgaggagggcccggcggcgctggccgggccgggcccggggcctgggggcgcggagggggcggccgaggagcgccgcgtcaaggtctccagcctgcccttcagcgtcgaggcgctcatgtcggacaagaagccgcccaagggggcgtccccgcggccggcagacagcgcctctgccggggccgccctgcggccgctgctgctgccgggacacggcgcccgggaagcccccagccccgggccgccggggaagcccttcgaggccgcctcggtcaagtcggagagcgccgaggacggagccgcgtggatgcaggagcccggcagatactcgccgccgccaagacatatgagccccaccacctgcaccctgcggaagcacaagaccaatcggaagccgagaacgcccttcaccacgtcgcagctcctcgccctggagcgcaagttccgccagaaacaatacctctccattgcagagcgcgcggagttctccagctctctgaacctcacagagacccaggttaaaatctggttccaaaaccgaagggccaaggcgaaaagactgcaggaggcagaactagaaaagctgaagatggctgcaaaacctatgctgccctctggcttcagccttcctttccccatcaactcgcctctgcaagcagcatccatatacggagcgtcctaccctttccatagacctgtgctccccatcccgcccgtcggactctatgcgaccccagtcggatatggcatgtaccatctatcctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]