GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 01:05:00, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001003049            3299 bp    mRNA    linear   MAM 26-JUN-2020
DEFINITION  Canis lupus familiaris cone-rod homeobox (CRX), mRNA.
ACCESSION   NM_001003049
VERSION     NM_001003049.1
KEYWORDS    RefSeq.
SOURCE      Canis lupus familiaris (dog)
  ORGANISM  Canis lupus familiaris
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;
            Canis.
REFERENCE   1  (bases 1 to 3299)
  AUTHORS   Akhmedov NB, Baldwin VJ, Zangerl B, Kijas JW, Hunter L, Minoofar
            KD, Mellersh C, Ostrander EA, Acland GM, Farber DB and Aguirre GD.
  TITLE     Cloning and characterization of the canine photoreceptor specific
            cone-rod homeobox (CRX) gene and evaluation as a candidate for
            early onset photoreceptor diseases in the dog
  JOURNAL   Mol. Vis. 8, 79-84 (2002)
   PUBMED   11951083
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF454668.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF454668.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA2240903 [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..3299
                     /organism="Canis lupus familiaris"
                     /mol_type="mRNA"
                     /sub_species="familiaris"
                     /db_xref="taxon:9615"
                     /chromosome="1"
                     /map="1"
     gene            1..3299
                     /gene="CRX"
                     /note="cone-rod homeobox"
                     /db_xref="GeneID:403577"
                     /db_xref="VGNC:VGNC:39632"
     exon            1..67
                     /gene="CRX"
                     /inference="alignment:Splign:2.1.0"
     exon            68..202
                     /gene="CRX"
                     /inference="alignment:Splign:2.1.0"
     CDS             103..1002
                     /gene="CRX"
                     /note="photoreceptor-specific cone-rod homeobox protein;
                     crx gene for cone-rod homeobox protein"
                     /codon_start=1
                     /product="cone-rod homeobox protein"
                     /protein_id="NP_001003049.1"
                     /db_xref="GeneID:403577"
                     /db_xref="VGNC:VGNC:39632"
                     /translation="
MMAYMNPGPHYSVNALALSGPSVDLMHQAVSYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKEQPQPPGAQTKARPAKRKAGMSPRSSSDVCPDPLGISDSYSPPLLGPSGSPTTAVATVSIWSPASESPLPEAQRGGLVASGPPLTSTPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGTYSPVDSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL"
     misc_feature    order(220..234,238..240,289..291,307..309,346..348,
                     352..357,364..369,373..381,385..387)
                     /gene="CRX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(226..228,235..237,355..357,364..369,376..378)
                     /gene="CRX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    229..387
                     /gene="CRX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    592..849
                     /gene="CRX"
                     /note="Otx1 transcription factor; Region: TF_Otx;
                     pfam03529"
                     /db_xref="CDD:281521"
     exon            203..354
                     /gene="CRX"
                     /inference="alignment:Splign:2.1.0"
     exon            355..3289
                     /gene="CRX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ccacctgaggactctgactccaaccaggtcctgggccaccaggagagcctgaccctgtttttggaaggcccgcagacctgggccacagtatccccaaagatcatgatggcgtatatgaacccggggccccactactcggtcaacgccttggccctcagcggtcccagcgtggatctgatgcaccaagctgtgtcctatccaagtgccccaagaaagcagcggcgggagcggaccaccttcacccggagccagctggaggagctagaggctctgttcgccaagactcaatacccggatgtgtatgctcgagaggaggtggctctgaagatcaacctacctgagtccagggttcaggtttggtttaagaaccgcagagctaaatgccggcagcagcgccagcagcagaaagagcagcctcagccccccggcgcacagaccaaggctcgtcctgccaagaggaaggcaggcatgtccccaagatcctcctccgacgtctgtccagaccccctaggcatctcagactcctacagcccccctctactcggcccctcaggctctcctaccacggccgtggccaccgtgtccatctggagtccagcctcagagtcccctttgcctgaggcccagcgcggagggctggtggcctcggggccacccctgacctccacaccctacgccatgacctacgcccctgcctctgctttctgctcctccccttcggcctacgggtctccgagctcctatttcagtggcctggatccctatctttcccccatggtgccccagttggggggcccagccctcagccccctttcaggcccctccgtgggaccctccctggcccagtcccccacttccctgtcaggccagagctatggcacctatagccccgtggacagcttggagtttaaggaccccacagggacctggaagttcacctacaaccccatggatcctctggactacaaagatcagagtgcctggaagtttcagatcttgtagaagatcctcttctgtatgtctctctgcatctcatctcaacccggcatccccaggaaagcagtggggctggccctccctccaaaagttgtggcctctctggcctcatgtgtggagtagcccaccacagtccacccccctctccccgggacagtctcctcactctccggggaagttcaatagatcttagtaaccctccacccagccccgcctcaccatggatgctggctgccattttaaccatgagccctggactccagaaactggtgctatgaatgtgctctgagatgaaattaaaccaaattcaagtagtcagtttaggggtcctggtcaggtcagaatcgagatgccctggaacagacaggtagggagactcaatgtcataccttccatttgggacacttccttagcatgtggctaggatccttctagaaaatccaaagatagttttaagaagccccaccatggcagcttaggtcagttgtacagttcaattaaaaaatccatttggcgattttacagatttcccaaatatcaagtttacatggtaggtttagggggctctttgatatatatttttttctttttagtttcttcttaaagacatttcgtcaggaatgcattcttttggactttgagagtggccatgtttggntttgttttaggattttctaaaggtggatttcaccccagcgctggaggaactgtggtagttgccactggggccaaccatggtagttggctccaacatagctgtgggtatatcaaaaaaaagaagaacaggaggtggcaggcttctcatttgtaaatatgcaagagacgaggttggcgggataagtggatttggaacaagccccacatttcaaaaatacagtccctctcttagattttgtttccattgcaggatgggaccagagagcgcagcctgatggagtggcaccatatttctttctgtgcgttgacccccagtgacagagacaagcactgagagacttttaagatggagtcaggcattttaacactcttggtagtttgatgctttggccttgcttgaattttttttttttttttttttttttttgtctttggccctgggaggcagtagccacgagcctttcactggtgggcttcacaaggtaaaaggaagtagggcaggaaggtggtggtgtgctggtatgtggtaaccattggctccctaaaagaagaggaaaaaccttgatttgtagtgattgccaatttctgtggtgtaaattatcccactatggctgatttcaaggcaccaagtctgtggtcatggcctcggagctggatgcatgccatctgtgctcatgggctggtaggaactggttccaggtcgccggtgtaggaagggatgtcaggaggcaggcacagtgtggagagaggctgggaggcctcagatggatttttctgggtccaggccagaagaggtccatatggactagaccccccaagaccctctgaaggggcacacggcggatcactggaatcctcaaggatggtttactcagcacaccacatgaccatgtctcatgggcctgagtcatactggcctctgggacattagacccaggagtgagtggctcagagtccagtgtgggacacaaaggataaacagaggaggacagtgcaggtgggggtggaagatagacgatccaagcagaatccgcagnngagggacagggaggaggtgacattgtgtaaaagttgggaccagatgcactgccattgattcattttgcagagactcccagagtctgtgctggaggnnggggtctcaggagtacataggaatttctctctgccccacggagctcccagagctctggttcacngnngagggtgtgtcttgtgaacacgaacaattcacaggcacgctgataagggggtccgggagagcatgaaggatggacgtcatgttctggaggagggtggaaggtgtagagcctggggggccacagtcacaggcccacaggctcagatgtcaggagacccctctcgctagggctggacagagcaagagggtgcatttgttcgggaggtcctggcttcctttcccggggccaacctcctgagctgtggggatgtcaaaggttctacttctttgagacaaaaagccaggacaagtgacaagagagagaaggaagcggccaggagcccccttcactctgtgttccctcccccactccttgagactccagtccccttccttccaggacaaccaccccccaccccaagcgaaaataattaaattgttgaatctcgctaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]