GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 07:30:22, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_198788               1292 bp    mRNA    linear   ROD 22-NOV-2023
DEFINITION  Rattus norvegicus succinate dehydrogenase complex subunit D (Sdhd),
            mRNA; nuclear gene for mitochondrial product.
ACCESSION   NM_198788 XM_343388
VERSION     NM_198788.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1292)
  AUTHORS   Fogarty MJ, Marin Mathieu N, Mantilla CB and Sieck GC.
  TITLE     Aging reduces succinate dehydrogenase activity in rat type IIx/IIb
            diaphragm muscle fibers
  JOURNAL   J Appl Physiol (1985) 128 (1), 70-77 (2020)
   PUBMED   31774353
  REMARK    GeneRIF: Aging reduces succinate dehydrogenase activity in rat type
            IIx/IIb diaphragm muscle fibers.
REFERENCE   2  (bases 1 to 1292)
  AUTHORS   Signes A and Fernandez-Vizarra E.
  TITLE     Assembly of mammalian oxidative phosphorylation complexes I-V and
            supercomplexes
  JOURNAL   Essays Biochem 62 (3), 255-270 (2018)
   PUBMED   30030361
  REMARK    Review article
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1292)
  AUTHORS   Pfleger J, He M and Abdellatif M.
  TITLE     Mitochondrial complex II is a source of the reserve respiratory
            capacity that is regulated by metabolic sensors and promotes cell
            survival
  JOURNAL   Cell Death Dis 6 (7), e1835 (2015)
   PUBMED   26225774
  REMARK    GeneRIF: Metabolic sensors via Sirt3 maximize the cellular reserve
            respiratory capacity through activating mitochondrial complex II,
            which enhances cell survival after hypoxia.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1292)
  AUTHORS   Bardella C, Pollard PJ and Tomlinson I.
  TITLE     SDH mutations in cancer
  JOURNAL   Biochim Biophys Acta 1807 (11), 1432-1443 (2011)
   PUBMED   21771581
  REMARK    Review article
REFERENCE   5  (bases 1 to 1292)
  AUTHORS   Forner F, Kumar C, Luber CA, Fromme T, Klingenspor M and Mann M.
  TITLE     Proteome differences between brown and white fat mitochondria
            reveal specialized metabolic functions
  JOURNAL   Cell Metab 10 (4), 324-335 (2009)
   PUBMED   19808025
REFERENCE   6  (bases 1 to 1292)
  AUTHORS   Mootha VK, Bunkenborg J, Olsen JV, Hjerrild M, Wisniewski JR, Stahl
            E, Bolouri MS, Ray HN, Sihag S, Kamal M, Patterson N, Lander ES and
            Mann M.
  TITLE     Integrated analysis of protein composition, tissue diversity, and
            gene regulation in mouse mitochondria
  JOURNAL   Cell 115 (5), 629-640 (2003)
   PUBMED   14651853
REFERENCE   7  (bases 1 to 1292)
  AUTHORS   Naito Y, Tsujino T, Kawasaki D, Okumura T, Morimoto S, Masai M,
            Sakoda T, Fujioka Y, Ohyanagi M and Iwasaki T.
  TITLE     Circadian gene expression of clock genes and plasminogen activator
            inhibitor-1 in heart and aorta of spontaneously hypertensive and
            Wistar-Kyoto rats
  JOURNAL   J Hypertens 21 (6), 1107-1115 (2003)
   PUBMED   12777947
REFERENCE   8  (bases 1 to 1292)
  AUTHORS   Kietzmann T, Jungermann K and Gorlach A.
  TITLE     Regulation of the hypoxia-dependent plasminogen activator inhibitor
            1 expression by MAP kinases
  JOURNAL   Thromb Haemost 89 (4), 666-673 (2003)
   PUBMED   12669121
REFERENCE   9  (bases 1 to 1292)
  AUTHORS   Baysal BE, Ferrell RE, Willett-Brozick JE, Lawrence EC, Myssiorek
            D, Bosch A, van der Mey A, Taschner PE, Rubinstein WS, Myers EN,
            Richard CW 3rd, Cornelisse CJ, Devilee P and Devlin B.
  TITLE     Mutations in SDHD, a mitochondrial complex II gene, in hereditary
            paraganglioma
  JOURNAL   Science 287 (5454), 848-851 (2000)
   PUBMED   10657297
REFERENCE   10 (bases 1 to 1292)
  AUTHORS   Hirawake H, Taniwaki M, Tamura A, Kojima S and Kita K.
  TITLE     Cytochrome b in human complex II (succinate-ubiquinone
            oxidoreductase): cDNA cloning of the components in liver
            mitochondria and chromosome assignment of the genes for the large
            (SDHC) and small (SDHD) subunits to 1q21 and 11q23
  JOURNAL   Cytogenet Cell Genet 79 (1-2), 132-138 (1997)
   PUBMED   9533030
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000198.1.
            
            On Mar 19, 2021 this sequence version replaced NM_198788.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ230166.1, FQ215355.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: inferred from homology
            RefSeq Select criteria             :: based on conservation,
                                                  expression, longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-111               JACYVU010000198.1  12767455-12767565   c
            112-228             JACYVU010000198.1  12765125-12765241   c
            229-373             JACYVU010000198.1  12763349-12763493   c
            374-1292            JACYVU010000198.1  12758013-12758931   c
FEATURES             Location/Qualifiers
     source          1..1292
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="8"
                     /map="8q23"
     gene            1..1292
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="succinate dehydrogenase complex subunit D"
                     /db_xref="GeneID:363061"
                     /db_xref="RGD:735231"
     exon            1..111
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    42..44
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="upstream in-frame stop codon"
     CDS             60..539
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="succinate-ubiquinone reductase membrane anchor
                     subunit; succinate-ubiquinone oxidoreductase cytochrome b
                     small subunit; succinate dehydrogenase complex, subunit D,
                     integral membrane protein"
                     /codon_start=1
                     /product="succinate dehydrogenase [ubiquinone] cytochrome
                     b small subunit, mitochondrial"
                     /protein_id="NP_942083.1"
                     /db_xref="GeneID:363061"
                     /db_xref="RGD:735231"
                     /translation="
MAVLLKLGVLCSGQGARALSLRSRAVRPAFVSAFLQDQPTPGWRGTQHIHLSPSHQSGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVHGDALQKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL"
     transit_peptide 60..227
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="Mitochondrion. /evidence=ECO:0000255; propagated
                     from UniProtKB/Swiss-Prot (Q6PCT8.1)"
     mat_peptide     228..536
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /product="Succinate dehydrogenase [ubiquinone] cytochrome
                     b small subunit, mitochondrial. /id=PRO_0000006489"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1)"
     misc_feature    237..533
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="SQR catalyzes the oxidation of succinate to
                     fumarate coupled to the reduction of quinone to quinol.
                     Eukaryotic SQRs reduce high potential quinones such as
                     ubiquinone. SQR is also called succinate dehydrogenase or
                     Complex II, and is part of the citric...; Region:
                     SQR_TypeC_CybS; cd03496"
                     /db_xref="CDD:239576"
     misc_feature    order(237..239,243..248,384..386,393..398,405..407)
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="Iron-sulfur protein interface [active]"
                     /db_xref="CDD:239576"
     misc_feature    249..314
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1);
                     transmembrane region"
     misc_feature    order(267..269,396..401,462..464,471..473,480..482,
                     495..497,513..515,528..530)
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="CybL subunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239576"
     misc_feature    order(306..311,519..521,528..530)
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="distal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239576"
     misc_feature    330..392
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1);
                     transmembrane region"
     misc_feature    order(363..365,375..377)
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="proximal heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239576"
     misc_feature    399..401
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239576"
     misc_feature    420..485
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6PCT8.1);
                     transmembrane region"
     exon            112..228
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /inference="alignment:Splign:2.1.0"
     exon            229..373
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /inference="alignment:Splign:2.1.0"
     exon            374..1292
                     /gene="Sdhd"
                     /gene_synonym="CII-4; cybS; QPs3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gggacttacgacataactgcttccgggccgtagggtgaccttgagccctcaaaagcgaaatggcggttctcttaaagctgggcgttctctgcagtggccaaggagctcgagctctgtcactccgaagccgggcggtcagacctgcttttgtgtccgcatttctccaggaccagcctaccccaggatggcgtggcacccagcacatccacctgtcaccaagccaccagtctggttccaaggccgcatctctccactggaccagtgagagggttgtcagtgttttgctcttgggcctgattccagctgggtacttgaatccctgctctgtggtggactactctctggctgcagccctcaccctgcacagtcactggggcattggacaagtggttactgactacgttcatggggacgcactgcagaaggctaccaaggcaggcctcttggcagtctcagctttgacctttgctgggctttgctacttcaattaccacgatgtaggcatctgcagagcggttgccatgctgtggaagctctgacctcttggtgtagcactttgattgtatgcctccttgcctctgctttatcaatgctgttcacctcacaatgaggagggatgaagaataaatccgttggtgggcagaatgtcttgtaattacatggctattttcagaatttatttgttgaggaattaggttcactcattcgtgagtctgagttccattgtcactgagtctggtcgccagctcatgtgactcatggtgtaactgaacatttcataagctcatgttgcctttgatcactgtttcttaaggagagccagctaattgctgtcaggataagagtagacttctctcctcagactgggagggaggactgttcattcgtgagtcagagtttgcatgaaattgaacagtattctgtttggaaccttccactcttgttcaggtggccccagctgttggtggctctgtttctaggggacttttaatcaggagatgccctcaattactgatgtttttaagtcttaggaaggaaattgaggaaagttagatttcgggaagttcaatttagggagctctcctttgtagaagggttcaaatatgacagatcgcaaacagacttactcttcaaatgtctctcacttgtgcaggaatgagctgtccaaaaaaagtaagactaagtaataaactgtcttcccaccgtgggagttgtcaatgagaaagtgtactctggaaaagcaaaatttttaaataaaatattatataatgattatacattgcactctttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]