GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 11:03:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_022636               1011 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA.
ACCESSION   NM_022636
VERSION     NM_022636.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1011)
  AUTHORS   Rajan S, Chu Pham Dang H, Djambazian H, Zuzan H, Fedyshyn Y, Ketela
            T, Moffat J, Hudson TJ and Sladek R.
  TITLE     Analysis of early C2C12 myogenesis identifies stably and
            differentially expressed transcriptional regulators whose
            knock-down inhibits myoblast differentiation
  JOURNAL   Physiol Genomics 44 (2), 183-197 (2012)
   PUBMED   22147266
REFERENCE   2  (bases 1 to 1011)
  AUTHORS   Kim JW and Lemke G.
  TITLE     Hedgehog-regulated localization of Vax2 controls eye development
  JOURNAL   Genes Dev 20 (20), 2833-2847 (2006)
   PUBMED   17043310
REFERENCE   3  (bases 1 to 1011)
  AUTHORS   Mui SH, Kim JW, Lemke G and Bertuzzi S.
  TITLE     Vax genes ventralize the embryonic eye
  JOURNAL   Genes Dev 19 (10), 1249-1259 (2005)
   PUBMED   15905411
REFERENCE   4  (bases 1 to 1011)
  AUTHORS   Soria JM, Taglialatela P, Gil-Perotin S, Galli R, Gritti A, Verdugo
            JM and Bertuzzi S.
  TITLE     Defective postnatal neurogenesis and disorganization of the rostral
            migratory stream in absence of the Vax1 homeobox gene
  JOURNAL   J Neurosci 24 (49), 11171-11181 (2004)
   PUBMED   15590934
REFERENCE   5  (bases 1 to 1011)
  AUTHORS   Taglialatela P, Soria JM, Caironi V, Moiana A and Bertuzzi S.
  TITLE     Compromised generation of GABAergic interneurons in the brains of
            Vax1-/- mice
  JOURNAL   Development 131 (17), 4239-4249 (2004)
   PUBMED   15280216
REFERENCE   6  (bases 1 to 1011)
  AUTHORS   Hallonet M, Hollemann T, Pieler T and Gruss P.
  TITLE     Vax1, a novel homeobox-containing gene, directs development of the
            basal forebrain and visual system
  JOURNAL   Genes Dev 13 (23), 3106-3114 (1999)
   PUBMED   10601036
REFERENCE   7  (bases 1 to 1011)
  AUTHORS   Bertuzzi S, Hindges R, Mui SH, O'Leary DD and Lemke G.
  TITLE     The homeodomain protein vax1 is required for axon guidance and
            major tract formation in the developing forebrain
  JOURNAL   Genes Dev 13 (23), 3092-3105 (1999)
   PUBMED   10601035
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF113515.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF113515.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1011
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q55"
     gene            1..1011
                     /gene="Vax1"
                     /note="ventral anterior homeobox 1"
                     /db_xref="GeneID:64571"
                     /db_xref="RGD:621132"
     CDS             1..1011
                     /gene="Vax1"
                     /note="ventral anterior homeobox containing gene 1"
                     /codon_start=1
                     /product="ventral anterior homeobox 1"
                     /protein_id="NP_072158.1"
                     /db_xref="GeneID:64571"
                     /db_xref="RGD:621132"
                     /translation="
MFGKTDKMDVRCHSDTEAARVSKNAHKESREIKGAEGSLPAAFLKEPQGAFSASGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAATAPGPAGAASQHPPAVGGAPGPGPAGPGGLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLTMAGSLAGNLQELSARYLSSSAFEPYSRTNNKEGAEKKALD"
     misc_feature    1..117
                     /gene="Vax1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JM00.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    148..207
                     /gene="Vax1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JM00.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    214..297
                     /gene="Vax1"
                     /note="Region: vax upstream domain"
     misc_feature    298..477
                     /gene="Vax1"
                     /note="Region: homeobox"
     misc_feature    order(301..315,319..321,370..372,388..390,427..429,
                     433..438,445..450,454..462,466..471)
                     /gene="Vax1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    307..468
                     /gene="Vax1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(307..309,316..318,436..438,445..450,457..459)
                     /gene="Vax1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    532..567
                     /gene="Vax1"
                     /note="Region: vax downstream domain"
     misc_feature    706..801
                     /gene="Vax1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JM00.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    943..969
                     /gene="Vax1"
                     /note="Region: vax terminal domain"
     exon            1..241
                     /gene="Vax1"
                     /inference="alignment:Splign:2.1.0"
     exon            242..429
                     /gene="Vax1"
                     /inference="alignment:Splign:2.1.0"
     exon            430..1011
                     /gene="Vax1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgttcgggaaaacagacaaaatggacgtccggtgccactcggacaccgaggccgccagggtatcgaagaacgcgcacaaggagagccgagagatcaagggcgccgaggggagccttccggctgccttcctcaaggagccgcagggcgccttttcggcgtctggcgcttccgaagattgtaacaaaagtaaatccaattcctcagcagacccagattactgccgccggatcctagtccgagatgccaaggggtctatccgagaaatcatcctgcccaagggcttggacctggaccggcccaagaggacacgcacgtccttcaccgcggagcagctctacagactggagatggagttccagcgttgccaatatgtagtgggccgggagagaaccgagctggctcggcagctcaatctttctgaaacccaggtgaaggtctggttccagaatcggcggaccaagcagaagaaggaccagggtaaagactcggagctgcgctcggtggtgtcggagaccgccgccacgtgcagcgtgctgcggctgttggagcaaggccgcctgttgtcgcctcccgggctgcccgccttgctgccgccctgtgctacaggcgctctgggctccgcgttgcgcgggcccagcctcccggccctgggtgcaggcgctgctgcgggctccgccgctgctgccgccgccgccgccactgccccgggtccggccggcgcggcgtcccagcatccgccagccgtgggcggcgctcccggccccgggcctgcagggcccgggggactgcacgcgggagctccgacagccagccacggtctcttcagcctgccggtgccgtcgctgctaggctctgtcgccagccgcctgtcctccgccccgttgacgatggctggttcgctagccgggaatttgcaagaactctcagcccgttacctgagctcctcggccttcgagccttactcccggaccaacaataaagaaggggccgagaaaaaagcgctggactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]