2024-05-20 10:54:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001109244 816 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus ladybird homeobox 2 (Lbx2), mRNA. ACCESSION NM_001109244 XM_001072452 XM_575575 VERSION NM_001109244.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 816) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473957.1. On or before Oct 4, 2007 this sequence version replaced XM_001072452.1, XM_575575.2. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMD00132278, SAMD00132284 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..816 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="4" /map="4q34" gene 1..816 /gene="Lbx2" /gene_synonym="RGD1561172" /note="ladybird homeobox 2" /db_xref="GeneID:500224" /db_xref="RGD:1561172" exon 1..256 /gene="Lbx2" /gene_synonym="RGD1561172" /inference="alignment:Splign:2.1.0" CDS 61..651 /gene="Lbx2" /gene_synonym="RGD1561172" /note="ladybird homeobox homolog 2" /codon_start=1 /product="transcription factor LBX2" /protein_id="NP_001102714.1" /db_xref="GeneID:500224" /db_xref="RGD:1561172" /translation="
MNSGRQRRTPFSIADILGRSMVPGAPSEPRLPEAGPDPASPLCALEELASKTFQGHSPRAPQPSEGRAVPEAPPGPGTGVRRRRKSRTAFTPQQVLELERRFVFQKYLAPSERDGLAARLGLANAQVVTWFQNRRAKLKRDVEEMRADLASLCGLSPGVLCPPALPDSASSPDLQPTPSGPDSEPGLSDEEIQVDD"
misc_feature order(310..324,328..330,379..381,397..399,436..438, 442..447,454..459,463..471,475..480) /gene="Lbx2" /gene_synonym="RGD1561172" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 316..477 /gene="Lbx2" /gene_synonym="RGD1561172" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(316..318,325..327,445..447,454..459,466..468) /gene="Lbx2" /gene_synonym="RGD1561172" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 257..816 /gene="Lbx2" /gene_synonym="RGD1561172" /inference="alignment:Splign:2.1.0" ORIGIN
cctaggaggttgtggaagccaagcgcagcgggaggcgggatcgctacaaccccgcttgccatgaattctggacgtcagcgccggacaccctttagcatcgcagacatcctcggtcggagcatggtccccggagcaccttctgagccacggcttcctgaagccggccctgatcctgcatcgccactgtgtgcgctggaggagcttgctagtaaaactttccagggccattctcctcgcgctccacagccttctgaaggcagagccgtcccggaggcgccgccgggtcctggcactggtgtccggagacgccgcaagtcgcgcaccgccttcactccacagcaggtgctggagctggagcggcgattcgtcttccagaagtacttggcaccgtcagagcgcgacggactggctgcacgactgggtctggctaatgcgcaagtggtcacttggttccagaaccgtcgcgccaagctcaagcgggatgtggaggagatgcgcgcggacctggcctccctgtgcgggttgtctccgggagtcctgtgccccccagcactgccagacagcgcttcaagccctgacctccagccaaccccttcagggcccgattccgagcccggcttatcagatgaagagatacaggtggacgattgaaagaaaagctgctgcctgccctggattcttgggccctggactcctgctaggggcttttgtctcggttcccgggtggagggtagagacccatttagctctgttctgttcctaactccacactcctacttttcttactcgttaagaataaagccgccgctctgctac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]