GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 03:17:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001102364            1544 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus claudin 6 (Cldn6), mRNA.
ACCESSION   NM_001102364 XM_001055688 XM_220202
VERSION     NM_001102364.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1544)
  AUTHORS   Harris HJ, Davis C, Mullins JG, Hu K, Goodall M, Farquhar MJ, Mee
            CJ, McCaffrey K, Young S, Drummer H, Balfe P and McKeating JA.
  TITLE     Claudin association with CD81 defines hepatitis C virus entry
  JOURNAL   J Biol Chem 285 (27), 21092-21102 (2010)
   PUBMED   20375010
REFERENCE   2  (bases 1 to 1544)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   3  (bases 1 to 1544)
  AUTHORS   Nunes FD, Lopez LN, Lin HW, Davies C, Azevedo RB, Gow A and Kachar
            B.
  TITLE     Distinct subdomain organization and molecular composition of a
            tight junction with adherens junction features
  JOURNAL   J Cell Sci 119 (Pt 23), 4819-4827 (2006)
   PUBMED   17130295
REFERENCE   4  (bases 1 to 1544)
  AUTHORS   Morita K, Furuse M, Yoshida Y, Itoh M, Sasaki H, Tsukita S and
            Miyachi Y.
  TITLE     Molecular architecture of tight junctions of periderm differs from
            that of the maculae occludentes of epidermis
  JOURNAL   J Invest Dermatol 118 (6), 1073-1079 (2002)
   PUBMED   12060405
REFERENCE   5  (bases 1 to 1544)
  AUTHORS   Morita K, Furuse M, Fujimoto K and Tsukita S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473948.1.
            
            On or before Aug 24, 2007 this sequence version replaced
            XM_220202.3, XM_001055688.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC168250.1, BU671697.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1544
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q12"
     gene            1..1544
                     /gene="Cldn6"
                     /note="claudin 6"
                     /db_xref="GeneID:287098"
                     /db_xref="RGD:1308837"
     exon            1..115
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    102..104
                     /gene="Cldn6"
                     /note="upstream in-frame stop codon"
     exon            116..1544
                     /gene="Cldn6"
                     /inference="alignment:Splign:2.1.0"
     CDS             132..791
                     /gene="Cldn6"
                     /codon_start=1
                     /product="claudin-6 precursor"
                     /protein_id="NP_001095834.1"
                     /db_xref="GeneID:287098"
                     /db_xref="RGD:1308837"
                     /translation="
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLIVLLGLLLYLAGAKCTTCVEDKNSKSRLVLISGVIFVISGVLTLIPICWTAHAIIQDFYNPLVADAQKRELGASLYLGWAASGLLLIGGGLLCCACSSGGTQGPSHYVARYSSPVPHSRGPSEYPSKNYV"
     sig_peptide     132..194
                     /gene="Cldn6"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    141..641
                     /gene="Cldn6"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
cccagctctgcgggcgccgccattaagcccctcctggtctcgcactcctaggcttggatatcgtgggtggccgaaccggacaggacgccctcggacaaagctgactgagcatttgccccctcaacctcatcatggcctctactggtctgcaaatcttggggattgtcctgaccctgcttggctgggtcaacgccctggtgtcctgtgccctgccgatgtggaaggtgaccgccttcatcggcaacagcatcgttgtggcccagatggtgtgggaggggctatggatgtcctgtgtggtccagagcactggtcagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgccagagccctctgtgtcatcaccctcctcattgtcctgcttggcctactcctgtaccttgccggagccaagtgcactacctgtgtggaagacaagaattccaagtctcgtctggtgctcatctctggtgtcatcttcgtcatctccggggtcctgaccctcattcccatctgctggactgcccacgccatcatccaggacttctacaaccccttggtcgcagacgctcaaaagcgagagctaggggcctccctctacctgggttgggccgcctcaggccttttgctgataggtggagggctgctatgctgcgcctgctcttctggagggacccagggacccagccattatgtggcccgctattcttcgcctgtcccacattctcggggaccctccgaatacccctccaagaattatgtctgatgcccactggggagtgaggctctactggccagagaacctgagctgagccgtgagaaatgatgtggggtagtttttggggtttgtcttgttccttgttttccttttgcaatgctgggtatgaaacctggggccccgcatatttggtaggcaagcactccacagtgagctgtgtggtaccctgccccctagggttggttccacctgtttttgagacaggctctccctaatggcgctctgactgacctccagctctcgttttttttttttttttgtttgtttgtttttttttcctgtctcaccctgagtccgaactccgcctatcgctccgttactggcatttctcgcttttacctactgtagctggagggatttgaccctgagttcctgtgtctttattcattctggggatctactgtgcaaagtgttttaaggctgcctgtgaatctggcctttgcgattctcaaaatggcttgtcccgagagttcctgctgtggctggaggtaactcacaggacagacacacccgctcctggtcaaactcttcccagtcctggaagggcaggtgataatttacctaagaattttcaactcagtcttccaacctttggcccctgaatcccatcaccaaggttactgtgtactctccccacatacggtcccagctgtgctgtagaccctcctcccccttacctctaaccttgcacatttccctgcccacacaatgttttacttaataaaacatgatttttttttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]