2024-05-20 08:23:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001024901 772 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus Rhox homeobox family member 12 (Rhox12), mRNA. ACCESSION NM_001024901 XM_343757 VERSION NM_001024901.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 772) AUTHORS Gaudet P, Livstone MS, Lewis SE and Thomas PD. TITLE Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium JOURNAL Brief Bioinform 12 (5), 449-462 (2011) PUBMED 21873635 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ058659.1. On Jun 17, 2005 this sequence version replaced XM_343757.1. ##Evidence-Data-START## Transcript exon combination :: DQ058659.1, CD372930.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760434 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..772 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..772 /gene="Rhox12" /note="Rhox homeobox family member 12" /db_xref="GeneID:363437" /db_xref="RGD:1563789" exon 1..144 /gene="Rhox12" /inference="alignment:Splign:2.1.0" misc_feature 120..122 /gene="Rhox12" /note="upstream in-frame stop codon" exon 145..553 /gene="Rhox12" /inference="alignment:Splign:2.1.0" CDS 153..680 /gene="Rhox12" /note="reproductive homeobox on X chromosome 12; reproductive homeobox 12" /codon_start=1 /product="Rhox homeobox family member 12" /protein_id="NP_001020072.1" /db_xref="GeneID:363437" /db_xref="RGD:1563789" /translation="
MALQSHHVEPSSYKLEENEIEVSLDADEAAEGGSFGEGSLNGSDKLKYEGIPDKDDRIYVGDVKYIGNDVKDEYRGSHQGSGDSQLEEQKNLASPTIPQFRRTRPRIQLGLTPRQLSELEDFFETTKYPDVITRRNLAKHLYLAESRVKRWFKRRRARYRKEQQTQMLKRASADR"
misc_feature 453..641 /gene="Rhox12" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(453..467,483..485,534..536,552..554,591..593, 597..602,609..614,618..626,630..635) /gene="Rhox12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(459..461,468..470,600..602,609..614,621..623) /gene="Rhox12" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 554..599 /gene="Rhox12" /inference="alignment:Splign:2.1.0" exon 600..772 /gene="Rhox12" /inference="alignment:Splign:2.1.0" ORIGIN
acctgttgagctgcctgcaggccgtagagtgtgcgttgggtttctagattttatgagccatcactcaggctgagatagactttggtgacgaagctgtctttgagtcatctctgctcctgtaagcaacccctcgcccatattcctattccaccatggctctccaatcccatcatgtggagcccagttcctacaaactggaggaaaatgagatcgaggtgagccttgatgctgatgaagcagcagagggaggcagcttcggagaaggttctctaaatggctcagacaaactaaagtacgagggcatcccagacaaggatgataggatctacgttggagacgtgaagtacattggtaatgacgtcaaagatgagtaccgtgggagccaccaagggtccggagattcacagctggaggagcagaagaacttggcttctcccacaatcccacagttccggcgcacaaggccacggatccagttgggtctcacgcccaggcagctgagtgaactggaagacttttttgaaactactaagtacccggatgtgatcacgagaagaaacctcgcaaagcacttgtacctggcagaatccagagtgaagagatggtttaagagaagaagagccagatacaggaaagaacagcagactcaaatgctcaagcgagcatctgctgataggtagaagaatgccatgcaacaaagcttttggaggagtcctgaagcatcttcctgtccaggcatcagatgaaggcacgttaggcactaatactcccc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]