GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 20:07:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_040687591             939 bp    mRNA    linear   VRT 01-MAR-2022
DEFINITION  PREDICTED: Gallus gallus claudin 9 (CLDN9), transcript variant X1,
            mRNA.
ACCESSION   XM_040687591
VERSION     XM_040687591.2
DBLINK      BioProject: PRJNA698614
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052591.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Mar 1, 2022 this sequence version replaced XM_040687591.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Gallus gallus Annotation Release 106
            Annotation Version          :: 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..939
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /isolate="bGalGal1"
                     /db_xref="taxon:9031"
                     /chromosome="19"
                     /sex="female"
                     /tissue_type="blood"
                     /country="USA: Fayetteville"
                     /lat_lon="36.0822 N 94.1719 W"
                     /collection_date="20-May-2019"
                     /collected_by="Nick Anthony"
     gene            1..939
                     /gene="CLDN9"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 109 long SRA reads, 41 Proteins,
                     and 100% coverage of the annotated genomic feature by
                     RNAseq alignments, including 23 samples with support for
                     all annotated introns"
                     /db_xref="CGNC:50521"
                     /db_xref="GeneID:417474"
     misc_feature    1
                     /gene="CLDN9"
                     /experiment="COORDINATES: cap analysis [ECO:0007248]"
                     /note="transcription start site"
     CDS             68..712
                     /gene="CLDN9"
                     /codon_start=1
                     /product="claudin-3"
                     /protein_id="XP_040543525.1"
                     /db_xref="GeneID:417474"
                     /db_xref="CGNC:50521"
                     /translation="
MATMSMQLGGLVLAVLGWLGSILTCALPMWKVTAFIGYNIVVAQVFWEGLWMNCVYESTGQMQCKAYDSLLDLTSDLQAARALVVTSIIMAFLGLLTAISGADCTRCMEDKSSKGRVSIVAGAIFVLAGIVLLIPVSWSANSIVTNFYNPMVPEALKRELGAALYIGWASSALQLLGGGILCCSGPPVERDHYPKSYRAVKGCGPMGYPMKDYV"
     misc_feature    77..610
                     /gene="CLDN9"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     polyA_site      939
                     /gene="CLDN9"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
gccccggccagggcacacagacgttcattgttgaagcccctttggcggcggcgaggagcaggtgccgatggcgacgatgtcgatgcagctgggcgggctggtgctggccgtgctgggctggctgggctccatcctcacctgcgcgctgcccatgtggaaggtgacggccttcatcggttacaacatcgtggtggcccaggtcttctgggaagggctgtggatgaactgcgtctacgagagcacggggcagatgcagtgcaaggcgtacgactccctgctggacctcacctccgacctgcaggccgcccgcgcgctggtggtcacctccatcatcatggccttcctcggcctcctcaccgccatctcgggggccgactgcacgcgctgcatggaggacaagagctccaagggccgtgtttccatcgtggcgggggccatcttcgtgctggccggcatcgtgctgctcatccccgtctcctggtctgccaacagcatcgtcaccaacttctacaaccccatggtgcccgaggccctcaagagagagctgggggctgccctgtacatcgggtgggcctccagcgccctgcagctgctgggtgggggtatcctgtgctgctcggggccgcccgtggagcgggaccactaccccaagtcataccgtgcggtgaagggctgtggccccatgggctaccccatgaaggactacgtgtgagctgcccccgctgggcaccaccggcccttgggcacagcaccgcggtccccatccctcccgcatcccacattccctgcctgcacactgcacactgcatccccacgccagctgcgtcccccccgtgctttgcccttcccgcaggctggtgacagcgtgtggccccatcccgctgccctcccggggcaccgctgctgctcccagctctataaaggtcttggtgccactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]