2024-05-17 17:27:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001045842 1059 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus distal-less homeobox 1 (DLX1), mRNA. ACCESSION NM_001045842 XM_426840 VERSION NM_001045842.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1059) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1059) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AY640309.1. On Sep 14, 2006 this sequence version replaced NM_001045842.1. ##Evidence-Data-START## Transcript exon combination :: AY640309.1, BU202505.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992527, SAMEA103992533 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1059 AY640309.1 1-1059 FEATURES Location/Qualifiers source 1..1059 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="7" /map="7" gene 1..1059 /gene="DLX1" /note="distal-less homeobox 1" /db_xref="CGNC:53614" /db_xref="GeneID:429283" exon 1..451 /gene="DLX1" /inference="alignment:Splign:2.1.0" misc_feature 70..72 /gene="DLX1" /note="upstream in-frame stop codon" CDS 139..906 /gene="DLX1" /note="homeodomain transcription factor DLX1" /codon_start=1 /product="homeobox protein DLX-1" /protein_id="NP_001039307.2" /db_xref="CGNC:53614" /db_xref="GeneID:429283" /translation="
MTMTTMPESLNSPVSGKAVFMEFGPPGQQMSPSPMSHGHYSMHCLHSAGHSQPDSAYSTASSFSRPLGYPYVNSVSSHSGNPYISSVQPYPNSSGLAQPRLEETGAESEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALESGALSNGRALSGGSPPVPAVWNTSSASGKASSGSAGTYIPSYTSWYPSAHQEAMQQPQLM"
misc_feature order(523..537,541..543,592..594,610..612,649..651, 655..660,667..672,676..684,688..693) /gene="DLX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 529..690 /gene="DLX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(529..531,538..540,658..660,667..672,679..681) /gene="DLX1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 452..651 /gene="DLX1" /inference="alignment:Splign:2.1.0" exon 652..1046 /gene="DLX1" /inference="alignment:Splign:2.1.0" ORIGIN
acaaactccattttcttatgaatggaaagtgaaaaccctgttccgcttaaattgggttctttcccgtcctgagaaacacaacagacccccaaaaggcacgctgaagagagagcacacacacagacccagcggcgagaaatgaccatgaccaccatgcctgagagtctaaacagccccgtctcggggaaggccgtctttatggagttcgggccgcccggccagcaaatgtctccttctcccatgtcccacggacactattccatgcactgtttacactcggcgggccactcgcagcccgacagcgcgtacagcacagcttcgtccttctcccgaccgctgggctacccctatgtgaactcggtgagcagccactccggcaacccctacatcagttcagtgcagccctaccccaacagctccggcctggcccagccccggctggaggagacaggggccgaatcggagaaaagcactgtggtagaaggaggggaagttcgctttaatgggaaagggaaaaaaatccgcaaacccaggactatttattccagtttgcagctgcaggctctgaacaggaggttccagcaaacccagtacctggccctgcccgagagagccgagctcgcggcctctctgggactcacccagactcaggtgaagatctggttccagaacaagcgctccaaattcaagaagctgatgaagcagggaggggcggccctggagagcggcgccctgagcaacggccgggccctgtccggcggctctcccccggtgcccgccgtgtggaacacctcctccgcctccgggaaggcgtcctcgggcagcgccggcacctacatccccagctacacgtcgtggtacccctcggcccaccaagaagctatgcagcagccgcagcttatgtgagcccgaacacgttttttcccgccgcgagccgaaaaaagaaaaatcaaattatcacggacaaaaaaaaaaaaaaaaaaaaaagaaaaagaaaaaaaaaagggaaaaaaaaagaaaaaaaaagaaaaaaaaagaaagtaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]