GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 17:27:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001045842            1059 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus distal-less homeobox 1 (DLX1), mRNA.
ACCESSION   NM_001045842 XM_426840
VERSION     NM_001045842.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1059)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1059)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AY640309.1.
            
            On Sep 14, 2006 this sequence version replaced NM_001045842.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY640309.1, BU202505.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992527, SAMEA103992533
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1059              AY640309.1         1-1059
FEATURES             Location/Qualifiers
     source          1..1059
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="7"
                     /map="7"
     gene            1..1059
                     /gene="DLX1"
                     /note="distal-less homeobox 1"
                     /db_xref="CGNC:53614"
                     /db_xref="GeneID:429283"
     exon            1..451
                     /gene="DLX1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    70..72
                     /gene="DLX1"
                     /note="upstream in-frame stop codon"
     CDS             139..906
                     /gene="DLX1"
                     /note="homeodomain transcription factor DLX1"
                     /codon_start=1
                     /product="homeobox protein DLX-1"
                     /protein_id="NP_001039307.2"
                     /db_xref="CGNC:53614"
                     /db_xref="GeneID:429283"
                     /translation="
MTMTTMPESLNSPVSGKAVFMEFGPPGQQMSPSPMSHGHYSMHCLHSAGHSQPDSAYSTASSFSRPLGYPYVNSVSSHSGNPYISSVQPYPNSSGLAQPRLEETGAESEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALESGALSNGRALSGGSPPVPAVWNTSSASGKASSGSAGTYIPSYTSWYPSAHQEAMQQPQLM"
     misc_feature    order(523..537,541..543,592..594,610..612,649..651,
                     655..660,667..672,676..684,688..693)
                     /gene="DLX1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    529..690
                     /gene="DLX1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(529..531,538..540,658..660,667..672,679..681)
                     /gene="DLX1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            452..651
                     /gene="DLX1"
                     /inference="alignment:Splign:2.1.0"
     exon            652..1046
                     /gene="DLX1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
acaaactccattttcttatgaatggaaagtgaaaaccctgttccgcttaaattgggttctttcccgtcctgagaaacacaacagacccccaaaaggcacgctgaagagagagcacacacacagacccagcggcgagaaatgaccatgaccaccatgcctgagagtctaaacagccccgtctcggggaaggccgtctttatggagttcgggccgcccggccagcaaatgtctccttctcccatgtcccacggacactattccatgcactgtttacactcggcgggccactcgcagcccgacagcgcgtacagcacagcttcgtccttctcccgaccgctgggctacccctatgtgaactcggtgagcagccactccggcaacccctacatcagttcagtgcagccctaccccaacagctccggcctggcccagccccggctggaggagacaggggccgaatcggagaaaagcactgtggtagaaggaggggaagttcgctttaatgggaaagggaaaaaaatccgcaaacccaggactatttattccagtttgcagctgcaggctctgaacaggaggttccagcaaacccagtacctggccctgcccgagagagccgagctcgcggcctctctgggactcacccagactcaggtgaagatctggttccagaacaagcgctccaaattcaagaagctgatgaagcagggaggggcggccctggagagcggcgccctgagcaacggccgggccctgtccggcggctctcccccggtgcccgccgtgtggaacacctcctccgcctccgggaaggcgtcctcgggcagcgccggcacctacatccccagctacacgtcgtggtacccctcggcccaccaagaagctatgcagcagccgcagcttatgtgagcccgaacacgttttttcccgccgcgagccgaaaaaagaaaaatcaaattatcacggacaaaaaaaaaaaaaaaaaaaaaagaaaaagaaaaaaaaaagggaaaaaaaaagaaaaaaaaagaaaaaaaaagaaagtaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]