2024-05-17 19:22:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001012293 1296 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus homeobox D4 (HOXD4), mRNA. ACCESSION NM_001012293 XM_421990 VERSION NM_001012293.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1296) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1296) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1296) AUTHORS Sasaki H, Yokoyama E and Kuroiwa A. TITLE Specific DNA binding of the two chicken Deformed family homeodomain proteins, Chox-1.4 and Chox-a JOURNAL Nucleic Acids Res 18 (7), 1739-1747 (1990) PUBMED 1970866 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000236.1. On Dec 14, 2021 this sequence version replaced NM_001012293.2. Sequence Note: This RefSeq record was created from genomic sequence data because no single transcript from the same breed was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. ##Evidence-Data-START## Transcript exon combination :: HAEL01003354.1, SRR13267657.13720.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN06140854 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-706 JAENSK010000236.1 8537213-8537918 c 707-1296 JAENSK010000236.1 8536325-8536914 c FEATURES Location/Qualifiers source 1..1296 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="7" /map="7" gene 1..1296 /gene="HOXD4" /gene_synonym="Chox-a" /note="homeobox D4" /db_xref="CGNC:52136" /db_xref="GeneID:424139" exon 1..706 /gene="HOXD4" /gene_synonym="Chox-a" /inference="alignment:Splign:2.1.0" misc_feature 217..219 /gene="HOXD4" /gene_synonym="Chox-a" /note="upstream in-frame stop codon" CDS 298..1011 /gene="HOXD4" /gene_synonym="Chox-a" /note="homeobox protein Hox-A" /codon_start=1 /product="homeobox protein Hox-D4" /protein_id="NP_001012293.1" /db_xref="CGNC:52136" /db_xref="GeneID:424139" /translation="
MAMSSYMVNSKYVDPKFPPCEEYLQSSYLGEQGAEYYGASQGSDFQHQGLYPRSNYSEQPFGCAGAQGSAVQPRGHGQEQSAPPSHFPGQAEHCPPPPMSNSRACGQQPALKAPHGSAVKQPAVVYPWMKKVHVNSVNPNYSGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSASNPHLQTVPKDHQTDLTTL"
misc_feature 535..>798 /gene="HOXD4" /gene_synonym="Chox-a" /note="superantigen-like protein SSL4; Reviewed; Region: PRK13042" /db_xref="CDD:183854" misc_feature order(736..750,754..756,805..807,823..825,862..864, 868..873,880..885,889..897,901..906) /gene="HOXD4" /gene_synonym="Chox-a" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 742..903 /gene="HOXD4" /gene_synonym="Chox-a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(742..744,751..753,871..873,880..885,892..894) /gene="HOXD4" /gene_synonym="Chox-a" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 707..1296 /gene="HOXD4" /gene_synonym="Chox-a" /inference="alignment:Splign:2.1.0" ORIGIN
gcacctgggggcagggaggcggccgcacgcggggaatggccccaaaactccgggatcggccccggagggcgaagcccgccgcggaggggtcgctcagctccgcgtatattatttagttaaattcgtggaaattctgaggcgcacacaaatccggtgatcggctccccgcctccccattggccgggccggtcacatgcacgcctaactttattcagttgacagcaagtaggagggctctatggaaggagaaaaaaagacaacacgagaaaaattagtattttctaccttccgaaattaatggccatgagttcgtatatggtgaactctaagtatgtggatcccaaatttcctccttgcgaggaatatttgcagagcagctacctaggcgagcagggggccgagtattacggggcctcgcagggctccgatttccagcaccaggggctctacccacggtcaaactacagcgagcagccctttggctgcgccggtgcccagggctctgccgtgcagccgcggggtcacggacaggagcagtccgcccctccgagccacttccccggccaagccgagcattgtcctccgcctccaatgtccaactcccgagcctgcggccagcagccagccctcaaagccccccacgggtcagcagttaagcagccagcagtagtttatccctggatgaagaaagtccatgttaactcggtgaaccccaattacagcggaggggaacctaagcgctcccgaacagcttacaccaggcagcaagtcctagaactggaaaaagaatttcattttaacaggtacctgacccggcgccgccgtatcgagatagcgcacactttgtgtctctctgagcgccagatcaagatctggtttcagaacagaagaatgaagtggaaaaaagaccacaaactgcccaacactaagggcaggtcttcctcctccgcttctaacccccacttacagactgttcccaaggaccatcagactgacttgacaactttatagaagaggtgaaattttccatttcatccttcgattctgaccagtactgtacataagtgacactatccaagcagaacctgcgtgtagcagccaaggactcgagaaactgccatctctccgtaaggtactgtggtacaaaggagactgaatgacgctactccggactttattttatttgcctctcgctagcacagaaagaaagggggggaaaaaaagcatcatacaggcagtaggaattgggaaagtcttaaacgagaccttctgtccataaaaagtaataaatcattg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]