2024-05-14 17:51:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_017352908 556 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio probable E3 ubiquitin-protein ligase HECTD4 (LOC101887156), transcript variant X3, mRNA. ACCESSION XM_017352908 VERSION XM_017352908.2 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007132.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jun 15, 2017 this sequence version replaced XM_017352908.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..556 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="21" gene 1..556 /gene="LOC101887156" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:101887156" CDS 79..387 /gene="LOC101887156" /codon_start=1 /product="probable E3 ubiquitin-protein ligase HECTD4 isoform X2" /protein_id="XP_017208397.1" /db_xref="GeneID:101887156" /translation="
MKDELQCQSCSPTGLFYQGKAQSVHEWLSMAISRGLHQGKNSLLELTKQICCFLQSAPEQFTLEEIPITESKVSMDVNFSGSSPAKRVNSKIPLCSKLHGLK"
ORIGIN
tcctgtagtgtgaactaggcttaaaacgcattagtgtatacggggcctaagccgaatgaaaaattaatgaataaatgaatgaaagatgagctgcagtgtcagagctgctctccgaccgggctcttctatcagggaaaagctcagagtgtccacgagtggctgagcatggccattagcagaggtctgcatcaggggaagaacagtctgctggagctcaccaaacagatctgctgcttcctgcagagtgcgcctgagcagtttacgctggaggagatacccatcaccgagtcaaaagtcagcatggacgtcaacttttccggctcgtctcctgcaaagagagtcaactcaaagattcctctctgttcaaagctccatgggcttaagtgatggtgtatggattcagtcataaagtgcagcgtaatggccagctgaacctgatggaggccgagtgtttcccgctggaggcctctccgtccaacaccggcctcacttctccacccacagccaaccagtatcctagcatcatcatccccaccgacaaagtgcacgacaaatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]