GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 06:49:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_131763               1145 bp    mRNA    linear   VRT 21-AUG-2023
DEFINITION  Danio rerio claudin b (cldnb), mRNA.
ACCESSION   NM_131763
VERSION     NM_131763.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1145)
  AUTHORS   Hughes SM, Escaleira RC, Wanders K, Koth J, Wilkinson DG and Xu Q.
  TITLE     Clonal behaviour of myogenic precursor cells throughout the
            vertebrate lifespan
  JOURNAL   Biol Open 11 (8) (2022)
   PUBMED   35972050
REFERENCE   2  (bases 1 to 1145)
  AUTHORS   Lin MJ, Lee CM, Hsu WL, Chen BC and Lee SJ.
  TITLE     Macrophages Break Interneuromast Cell Quiescence by Intervening in
            the Inhibition of Schwann Cells in the Zebrafish Lateral Line
  JOURNAL   Front Cell Dev Biol 10, 907863 (2022)
   PUBMED   35846366
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1145)
  AUTHORS   Marsay KS, Greaves S, Mahabaleshwar H, Ho CM, Roehl H, Monk PN,
            Carney TJ and Partridge LJ.
  TITLE     Tetraspanin Cd9b and Cxcl12a/Cxcr4b have a synergistic effect on
            the control of collective cell migration
  JOURNAL   PLoS One 16 (11), e0260372 (2021)
   PUBMED   34847198
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1145)
  AUTHORS   Dalle Nogare DE, Natesh N, Vishwasrao HD, Shroff H and Chitnis AB.
  TITLE     Zebrafish Posterior Lateral Line primordium migration requires
            interactions between a superficial sheath of motile cells and the
            skin
  JOURNAL   Elife 9, e58251 (2020)
   PUBMED   33237853
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1145)
  AUTHORS   Solis CJ, Hamilton MK, Caruffo M, Garcia-Lopez JP, Navarrete P,
            Guillemin K and Feijoo CG.
  TITLE     Intestinal Inflammation Induced by Soybean Meal Ingestion Increases
            Intestinal Permeability and Neutrophil Turnover Independently of
            Microbiota in Zebrafish
  JOURNAL   Front Immunol 11, 1330 (2020)
   PUBMED   32793187
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1145)
  AUTHORS   Sarrazin AF, Villablanca EJ, Nunez VA, Sandoval PC, Ghysen A and
            Allende ML.
  TITLE     Proneural gene requirement for hair cell differentiation in the
            zebrafish lateral line
  JOURNAL   Dev Biol 295 (2), 534-545 (2006)
   PUBMED   16678150
REFERENCE   7  (bases 1 to 1145)
  AUTHORS   Haas P and Gilmour D.
  TITLE     Chemokine signaling mediates self-organizing tissue migration in
            the zebrafish lateral line
  JOURNAL   Dev Cell 10 (5), 673-680 (2006)
   PUBMED   16678780
REFERENCE   8  (bases 1 to 1145)
  AUTHORS   Lopez-Schier H, Starr CJ, Kappler JA, Kollmar R and Hudspeth AJ.
  TITLE     Directional cell migration establishes the axes of planar polarity
            in the posterior lateral-line organ of the zebrafish
  JOURNAL   Dev Cell 7 (3), 401-412 (2004)
   PUBMED   15363414
REFERENCE   9  (bases 1 to 1145)
  AUTHORS   Malek RL, Sajadi H, Abraham J, Grundy MA and Gerhard GS.
  TITLE     The effects of temperature reduction on gene expression and
            oxidative stress in skeletal muscle from adult zebrafish
  JOURNAL   Comp Biochem Physiol C Toxicol Pharmacol 138 (3), 363-373 (2004)
   PUBMED   15533794
REFERENCE   10 (bases 1 to 1145)
  AUTHORS   Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CR847847.6, BC078358.1 and AF359426.1.
            
            On May 1, 2009 this sequence version replaced NM_131763.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-21                CR847847.6         60310-60330         c
            22-837              BC078358.1         1-816
            838-1145            AF359426.1         813-1120
FEATURES             Location/Qualifiers
     source          1..1145
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="21"
                     /map="21"
     gene            1..1145
                     /gene="cldnb"
                     /gene_synonym="cldn30c; wu:fa66b05"
                     /note="claudin b"
                     /db_xref="GeneID:81581"
                     /db_xref="ZFIN:ZDB-GENE-010328-2"
     exon            1..1129
                     /gene="cldnb"
                     /gene_synonym="cldn30c; wu:fa66b05"
                     /inference="alignment:Splign:2.1.0"
     CDS             69..716
                     /gene="cldnb"
                     /gene_synonym="cldn30c; wu:fa66b05"
                     /codon_start=1
                     /product="claudin b"
                     /protein_id="NP_571838.1"
                     /db_xref="GeneID:81581"
                     /db_xref="ZFIN:ZDB-GENE-010328-2"
                     /translation="
MASTGLQMLGIALAIFGWIGVIVLCALPMWKVTAFIGANIVTSQTSWEGIWMSCVVQSTGQMQCKVYDSMLALSSDIQAARALTVISIVIGVMGIMLSMAGGKCTNCIEEESSKAKVGITAGVIFIISGVLCLVPVCWTANAIIQDFYNPLVVQAQKREIGASLYIGWGASALLIIGGSLLCCHCPEKSDSGKYTAKYNATPRSEASAPSGKNFV"
     misc_feature    78..611
                     /gene="cldnb"
                     /gene_synonym="cldn30c; wu:fa66b05"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
tcacacacacacgcttgataagactgcgaagagaaccaccaaccaaccaacaaggaaaacgaaaaagcatggcatcaaccggcctacagatgctgggcatcgccctggccatctttgggtggatcggagtcattgtgctctgcgcactccccatgtggaaagtcacagccttcatcggcgccaacattgtcacttcacagacatcctgggaaggaatttggatgagctgcgtggttcaaagcactggacagatgcagtgtaaggtctacgactccatgctggctctctcctcagatattcaagccgctcgagctctcaccgtcatctccatcgtgatcggagtcatgggaatcatgctgtcgatggctggtggaaaatgcaccaactgcatcgaggaggagagctccaaagccaaggttgggatcacggcaggtgtgattttcatcatctctggggtgctatgtctggtcccggtgtgctggacggctaacgctatcatccaggacttctacaacccgctagtggtccaggcacagaagagggagattggagcgtcactgtacatcggctggggtgcctcagctctgttgatcattggtggaagtctgctctgttgccactgccccgaaaaatcagacagcggaaaatacacagctaaatacaacgcaacccctcgctctgaagcctctgcaccctccggaaagaactttgtgtaaatgatcaactcaggaaaatggactctacaatgtttacggtcttagtttgttggacattgaggctcaaaatgagtttgcaggacttgaaaagcagatgctgaatgtttttttttttttttttttttaccaatatatatgcaaaacaaacaaagaaaatggggaaccacgtttgaaacagcctctgcagttaaaggaggttaacctgaaaattatttttgcttaagtttggtcaaatgttcttttgtaccgtggtcattataaaagtgttcacttttgtatgttttcaagtatgattttgtaaatattagcatttttgtacagcctaagtacaggtttttctacaactttgtacaggtttatttcttgatatatgtttaaaggaattaataaataaatacattttgttaatatcaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]