2024-05-15 13:55:47, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131589 1175 bp mRNA linear VRT 20-FEB-2022 DEFINITION Danio rerio NK2 homeobox 4b (nkx2.4b), mRNA. ACCESSION NM_131589 VERSION NM_131589.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1175) AUTHORS Yan YL, Titus T, Desvignes T, BreMiller R, Batzel P, Sydes J, Farnsworth D, Dillon D, Wegner J, Phillips JB, Peirce J, Dowd J, Buck CL, Miller A, Westerfield M and Postlethwait JH. CONSRTM Undiagnosed Diseases Network TITLE A fish with no sex: gonadal and adrenal functions partition between zebrafish NR5A1 co-orthologs JOURNAL Genetics 217 (2) (2021) PUBMED 33724412 REMARK Erratum:[Genetics. 2021 May 17;218(1):. PMID: 33826717] REFERENCE 2 (bases 1 to 1175) AUTHORS Chu S, Kwon BR, Lee YM, Zoh KD and Choi K. TITLE Effects of 2-ethylhexyl-4-methoxycinnamate (EHMC) on thyroid hormones and genes associated with thyroid, neurotoxic, and nephrotoxic responses in adult and larval zebrafish (Danio rerio) JOURNAL Chemosphere 263, 128176 (2021) PUBMED 33297144 REFERENCE 3 (bases 1 to 1175) AUTHORS Kim J, Lee G, Lee YM, Zoh KD and Choi K. TITLE Thyroid disrupting effects of perfluoroundecanoic acid and perfluorotridecanoic acid in zebrafish (Danio rerio) and rat pituitary (GH3) cell line JOURNAL Chemosphere 262, 128012 (2021) PUBMED 33182161 REFERENCE 4 (bases 1 to 1175) AUTHORS Chen X, Teng M, Zhang J, Qian L, Duan M, Cheng Y, Zhao F, Zheng J and Wang C. TITLE Tralopyril induces developmental toxicity in zebrafish embryo (Danio rerio) by disrupting the thyroid system and metabolism JOURNAL Sci Total Environ 746, 141860 (2020) PUBMED 33027873 REFERENCE 5 (bases 1 to 1175) AUTHORS Lee S, Eghan K, Lee J, Yoo D, Yoon S and Kim WK. TITLE Zebrafish Embryonic Exposure to BPAP and Its Relatively Weak Thyroid Hormone-Disrupting Effects JOURNAL Toxics 8 (4), E103 (2020) PUBMED 33202880 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 1175) AUTHORS Elsalini OA and Rohr KB. TITLE Phenylthiourea disrupts thyroid function in developing zebrafish JOURNAL Dev Genes Evol 212 (12), 593-598 (2003) PUBMED 12536323 REFERENCE 7 (bases 1 to 1175) AUTHORS Mathieu J, Barth A, Rosa FM, Wilson SW and Peyrieras N. TITLE Distinct and cooperative roles for Nodal and Hedgehog signals during hypothalamic development JOURNAL Development 129 (13), 3055-3065 (2002) PUBMED 12070082 REMARK GeneRIF: There exists cooperation between Nodal and Hedgehog pathways in the maintenance of the anterior-dorsal hypothalamus. REFERENCE 8 (bases 1 to 1175) AUTHORS Rohr KB, Barth KA, Varga ZM and Wilson SW. TITLE The nodal pathway acts upstream of hedgehog signaling to specify ventral telencephalic identity JOURNAL Neuron 29 (2), 341-351 (2001) PUBMED 11239427 REFERENCE 9 (bases 1 to 1175) AUTHORS Shanmugalingam S, Houart C, Picker A, Reifers F, Macdonald R, Barth A, Griffin K, Brand M and Wilson SW. TITLE Ace/Fgf8 is required for forebrain commissure formation and patterning of the telencephalon JOURNAL Development 127 (12), 2549-2561 (2000) PUBMED 10821754 REFERENCE 10 (bases 1 to 1175) AUTHORS Barth KA, Kishimoto Y, Rohr KB, Seydler C, Schulte-Merker S and Wilson SW. TITLE Bmp activity establishes a gradient of positional information throughout the entire neural plate JOURNAL Development 126 (22), 4977-4987 (1999) PUBMED 10529416 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF253054.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF253054.1, BC162307.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505371, SAMEA3505372 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1175 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="20" /map="20" gene 1..1175 /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /note="NK2 homeobox 4b" /db_xref="GeneID:58112" /db_xref="ZFIN:ZDB-GENE-000830-1" exon 1..377 /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /inference="alignment:Splign:2.1.0" misc_feature 29..31 /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /note="upstream in-frame stop codon" CDS 35..958 /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /note="thyroid transcription factor 1a; NK2 homeobox 1a; NK2 homeobox 2.4b" /codon_start=1 /product="NK2 homeobox 4b" /protein_id="NP_571664.1" /db_xref="GeneID:58112" /db_xref="ZFIN:ZDB-GENE-000830-1" /translation="
MSLSPKHSTPFSVSDILSPIEETFKKFAAMESSASLASPLYRQSQVSQANLQQHSMSHNAYHMPHSQFSHSTMGGYCNGTIGAMGDLPSYQESMRNGATATAWYGSNPEPRYPTISRFMGPSAGMNMGTLPGMDASKSMVTLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKASQQQDSGNMCAQQSPRRVALPVLVKDGKPCQNGSGTPTPIHQQVQSVLGSETLASAEDLEEMSPSPPLMGGLSQTDAALIEYTSSMVSSNLLYGRTW"
misc_feature order(476..490,494..496,545..547,563..565,602..604, 608..613,620..625,629..637,641..646) /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 482..643 /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(482..484,491..493,611..613,620..625,632..634) /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 378..1152 /gene="nkx2.4b" /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1; titf1a" /inference="alignment:Splign:2.1.0" ORIGIN
ggcagcttcagcaaacctgctcgcgggctgaaccatgtccttgagccccaaacactcaacgcctttctcagtgagcgatattttgagcccgatcgaggagaccttcaagaagtttgcagccatggagagcagcgcgagcctggcgtctcctctatatcgacagagtcaggtgtctcaggctaatttgcagcagcacagcatgagccataacgcgtaccacatgccgcactcgcagttctcgcatagcaccatgggcggatattgcaacgggactatcggtgcaatgggggacctgccatcctaccaggagagcatgagaaacggcgccacggccacggcttggtacggctcgaacccggagccgagatacccaacaatctccaggtttatgggtccctcggcgggcatgaacatgggcacgttaccgggaatggacgccagtaaatctatggtaactctacacgcggcgccgcgcaggaaacggcgcgtgcttttctcccaagcgcaggtatacgagctggagcgccgcttcaagcagcaaaaatacctgtcggccccggagagggaacatttggccagcatgatccatctaaccccgacgcaggtcaagatctggttccagaaccacaggtacaaaatgaagcggcaggcgaaggataaagcgtcccagcagcaggacagcgggaacatgtgcgcgcagcagtcgccaaggcgcgtggccctgcctgtgcttgttaaggacggtaaaccgtgtcagaacggctccggcacgccgacgccgatccatcaacaggtgcaaagcgtcctgggcagcgagactttagcttcagccgaggatctggaggaaatgtcgcctagtccgcctctgatgggcggcctctctcagactgacgccgcgctcatcgagtacacgagcagcatggtgagctccaacctgctgtacggcagaacatggtgatatttcacaaactacaacaacaacaaaaaaaaatcctcatttttaatcaactgacggacggagatatgtgcatttccacaaagacctttttttaaagaattgtttttttattttacgcacttgctttttggtgcaggagcctctttgacgtgaattgtatacggatttgtgagtttaaatcattattgactgaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]