GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-15 19:14:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_131158               1453 bp    mRNA    linear   VRT 30-SEP-2023
DEFINITION  Danio rerio developing brain homeobox 1a (dbx1a), mRNA.
ACCESSION   NM_131158
VERSION     NM_131158.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1453)
  AUTHORS   Brozko N, Baggio S, Lipiec MA, Jankowska M, Szewczyk LM, Gabriel
            MO, Chakraborty C, Ferran JL and Wisniewska MB.
  TITLE     Genoarchitecture of the Early Postmitotic Pretectum and the Role of
            Wnt Signaling in Shaping Pretectal Neurochemical Anatomy in
            Zebrafish
  JOURNAL   Front Neuroanat 16, 838567 (2022)
   PUBMED   35356436
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1453)
  AUTHORS   Scott K, O'Rourke R, Winkler CC, Kearns CA and Appel B.
  TITLE     Temporal single-cell transcriptomes of zebrafish spinal cord pMN
            progenitors reveal distinct neuronal and glial progenitor
            populations
  JOURNAL   Dev Biol 479, 37-50 (2021)
   PUBMED   34303700
REFERENCE   3  (bases 1 to 1453)
  AUTHORS   Mukaigasa K, Sakuma C and Yaginuma H.
  TITLE     The developmental hourglass model is applicable to the spinal cord
            based on single-cell transcriptomes and non-conserved
            cis-regulatory elements
  JOURNAL   Dev Growth Differ 63 (7), 372-391 (2021)
   PUBMED   34473348
REFERENCE   4  (bases 1 to 1453)
  AUTHORS   Yildiz O, Downes GB and Sagerstrom CG.
  TITLE     Zebrafish prdm12b acts independently of nkx6.1 repression to
            promote eng1b expression in the neural tube p1 domain
  JOURNAL   Neural Dev 14 (1), 5 (2019)
   PUBMED   30813944
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1453)
  AUTHORS   Piragyte I, Clapes T, Polyzou A, Klein Geltink RI, Lefkopoulos S,
            Yin N, Cauchy P, Curtis JD, Klaeyle L, Langa X, Beckmann CCA,
            Wlodarski MW, Muller P, Van Essen D, Rambold A, Kapp FG, Mione M,
            Buescher JM, Pearce EL, Polyzos A and Trompouki E.
  TITLE     A metabolic interplay coordinated by HLX regulates myeloid
            differentiation and AML through partly overlapping pathways
  JOURNAL   Nat Commun 9 (1), 3090 (2018)
   PUBMED   30082823
  REMARK    GeneRIF: HLX has a role in coordinating metabolic interplay
            regulates myeloid differentiation both in zebrafish and human
            hematopoietic stem and progenitor cells and in acute myeloid
            leukemia through partly overlapping pathways
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1453)
  AUTHORS   Abdelilah S and Driever W.
  TITLE     Pattern formation in janus-mutant zebrafish embryos
  JOURNAL   Dev Biol 184 (1), 70-84 (1997)
   PUBMED   9142985
REFERENCE   7  (bases 1 to 1453)
  AUTHORS   Solnica-Krezel L, Stemple DL, Mountcastle-Shah E, Rangini Z,
            Neuhauss SC, Malicki J, Schier AF, Stainier DY, Zwartkruis F,
            Abdelilah S and Driever W.
  TITLE     Mutations affecting cell fates and cellular rearrangements during
            gastrulation in zebrafish
  JOURNAL   Development 123, 67-80 (1996)
   PUBMED   9007230
REFERENCE   8  (bases 1 to 1453)
  AUTHORS   Hauptmann G and Gerster T.
  TITLE     Complex expression of the zp-50 pou gene in the embryonic zebrafish
            brain is altered by overexpression of sonic hedgehog
  JOURNAL   Development 122 (6), 1769-1780 (1996)
   PUBMED   8674416
REFERENCE   9  (bases 1 to 1453)
  AUTHORS   Zhang Z, Balmer JE, Lovlie A, Fromm SH and Blomhoff R.
  TITLE     Specific teratogenic effects of different retinoic acid isomers and
            analogs in the developing anterior central nervous system of
            zebrafish
  JOURNAL   Dev Dyn 206 (1), 73-86 (1996)
   PUBMED   9019248
REFERENCE   10 (bases 1 to 1453)
  AUTHORS   Barth KA and Wilson SW.
  TITLE     Expression of zebrafish nk2.2 is influenced by sonic
            hedgehog/vertebrate hedgehog-1 and demarcates a zone of neuronal
            differentiation in the embryonic forebrain
  JOURNAL   Development 121 (6), 1755-1768 (1995)
   PUBMED   7600991
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF030284.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF030284.1, BC164106.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA2168448, SAMEA3505370
                                           [ECO:0000350]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1453
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="7"
                     /map="7"
     gene            1..1453
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="developing brain homeobox 1a"
                     /db_xref="GeneID:30394"
                     /db_xref="ZFIN:ZDB-GENE-000128-8"
     exon            1..443
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /inference="alignment:Splign:2.1.0"
     CDS             95..1039
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="homeobox protein hlx1; developing brain homeobox
                     protein 1-A; H2.0-like homeobox 1"
                     /codon_start=1
                     /product="homeobox protein DBX1-A"
                     /protein_id="NP_571233.1"
                     /db_xref="GeneID:30394"
                     /db_xref="ZFIN:ZDB-GENE-000128-8"
                     /translation="
MMIPSVIAPPAIYSAFMRPAASLHSPFPAHPSFLVEDLLRINRPSGFLSQTAHSPCASPPNSTPLSIPDNCRILDRVSPGITEKHGPCSPKTPVSSKDPTYLKFGVSAILAPSPKKATSPPSVHSIHPKGFSVPYFDGSFCPFVRSSYFPAPSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKTNPHPDLSDVGKKSSEDEDEDDACAPSHFCLSPRRVMSNSTDSSITFKHSDFSESEDEITVS"
     misc_feature    order(626..634,638..640,689..691,707..709,746..748,
                     752..757,764..769,773..781,785..790)
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    626..787
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(626..628,635..637,755..757,764..769,776..778)
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    794..931
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9PTU1.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    968..1036
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9PTU1.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            444..545
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /inference="alignment:Splign:2.1.0"
     exon            546..748
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /inference="alignment:Splign:2.1.0"
     exon            749..1426
                     /gene="dbx1a"
                     /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04;
                     zgc:109861"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agcaaatcgtcattcggtcagttcagagcttgccaggagagacttgtgtaatactaacaggagtcatttaagtcatcttttaatagccgggaccatgatgatcccaagtgttattgcaccacctgctatatattcagcatttatgcgtcctgctgcatcgctgcattcaccctttccagctcacccgagcttcctggtggaggaccttctgcgcatcaacagacccagcggtttcctgagccaaaccgcgcactctccatgcgcatctcctccaaattcaacgcctctttccatcccggataactgcaggattttggacagagttagccctggcatcacggaaaagcatggaccttgctcccccaaaacgccagtctccagcaaggatccaacatatttaaagtttggagtgagtgccattttggcaccgtcaccaaagaaagccacatctccaccctccgtccacagcatacaccctaaaggattctctgtgccttattttgatggttcattctgccctttcgtccgttcttcatacttccctgctccttcatcggtcgtgcccattcctggaactttttcctggcctcttgctgcgagagggaagcccagaagagggatgctccgccgggctgtgttttcagatgtgcagcgcaaagctctggagaaaatgttccaaaagcaaaaatacatcagcaagccagaccggaaaaaacttgcagccaaactcggactaaaagattcacaggtcaaaatctggttccagaatcggcgaatgaaatggagaaactccaaggagagggagttgctttcatccggaggctgccgggagcaaaccctgccaaccaaaacaaaccctcacccagacctaagcgacgtgggtaaaaagtcttccgaagatgaagatgaagacgacgcatgcgctccatcgcatttctgtctctcacccagacgcgtaatgtcaaacagcactgattccagcattacatttaaacactcggacttttctgaatcagaggatgaaataacagtctcataagcaaattcatgagctgcataatgtctgtatttcaagcacaacgttatgttcaaccacgttatggttccactggcgtataatttcacttctatgtacaaatgagtgtttgtagcaaaatcttttccacatcactttatatttacttatttggaaaacctcgcaaaatgattttgctgtgtcgcacagctttttgtggggaactgtacagtattttgtacaaatatttttgtatggatattttataccaagaattttgagttttagattctttattaaagttgtagacgtatgtataatttatacgaatttatcccttcgtgccacattgtatgcatatgtatatgttgaaaatgttttgtattgtttgcaaataaattgtaaatttaaagaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]