2024-05-15 19:14:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131158 1453 bp mRNA linear VRT 30-SEP-2023 DEFINITION Danio rerio developing brain homeobox 1a (dbx1a), mRNA. ACCESSION NM_131158 VERSION NM_131158.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1453) AUTHORS Brozko N, Baggio S, Lipiec MA, Jankowska M, Szewczyk LM, Gabriel MO, Chakraborty C, Ferran JL and Wisniewska MB. TITLE Genoarchitecture of the Early Postmitotic Pretectum and the Role of Wnt Signaling in Shaping Pretectal Neurochemical Anatomy in Zebrafish JOURNAL Front Neuroanat 16, 838567 (2022) PUBMED 35356436 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1453) AUTHORS Scott K, O'Rourke R, Winkler CC, Kearns CA and Appel B. TITLE Temporal single-cell transcriptomes of zebrafish spinal cord pMN progenitors reveal distinct neuronal and glial progenitor populations JOURNAL Dev Biol 479, 37-50 (2021) PUBMED 34303700 REFERENCE 3 (bases 1 to 1453) AUTHORS Mukaigasa K, Sakuma C and Yaginuma H. TITLE The developmental hourglass model is applicable to the spinal cord based on single-cell transcriptomes and non-conserved cis-regulatory elements JOURNAL Dev Growth Differ 63 (7), 372-391 (2021) PUBMED 34473348 REFERENCE 4 (bases 1 to 1453) AUTHORS Yildiz O, Downes GB and Sagerstrom CG. TITLE Zebrafish prdm12b acts independently of nkx6.1 repression to promote eng1b expression in the neural tube p1 domain JOURNAL Neural Dev 14 (1), 5 (2019) PUBMED 30813944 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1453) AUTHORS Piragyte I, Clapes T, Polyzou A, Klein Geltink RI, Lefkopoulos S, Yin N, Cauchy P, Curtis JD, Klaeyle L, Langa X, Beckmann CCA, Wlodarski MW, Muller P, Van Essen D, Rambold A, Kapp FG, Mione M, Buescher JM, Pearce EL, Polyzos A and Trompouki E. TITLE A metabolic interplay coordinated by HLX regulates myeloid differentiation and AML through partly overlapping pathways JOURNAL Nat Commun 9 (1), 3090 (2018) PUBMED 30082823 REMARK GeneRIF: HLX has a role in coordinating metabolic interplay regulates myeloid differentiation both in zebrafish and human hematopoietic stem and progenitor cells and in acute myeloid leukemia through partly overlapping pathways Publication Status: Online-Only REFERENCE 6 (bases 1 to 1453) AUTHORS Abdelilah S and Driever W. TITLE Pattern formation in janus-mutant zebrafish embryos JOURNAL Dev Biol 184 (1), 70-84 (1997) PUBMED 9142985 REFERENCE 7 (bases 1 to 1453) AUTHORS Solnica-Krezel L, Stemple DL, Mountcastle-Shah E, Rangini Z, Neuhauss SC, Malicki J, Schier AF, Stainier DY, Zwartkruis F, Abdelilah S and Driever W. TITLE Mutations affecting cell fates and cellular rearrangements during gastrulation in zebrafish JOURNAL Development 123, 67-80 (1996) PUBMED 9007230 REFERENCE 8 (bases 1 to 1453) AUTHORS Hauptmann G and Gerster T. TITLE Complex expression of the zp-50 pou gene in the embryonic zebrafish brain is altered by overexpression of sonic hedgehog JOURNAL Development 122 (6), 1769-1780 (1996) PUBMED 8674416 REFERENCE 9 (bases 1 to 1453) AUTHORS Zhang Z, Balmer JE, Lovlie A, Fromm SH and Blomhoff R. TITLE Specific teratogenic effects of different retinoic acid isomers and analogs in the developing anterior central nervous system of zebrafish JOURNAL Dev Dyn 206 (1), 73-86 (1996) PUBMED 9019248 REFERENCE 10 (bases 1 to 1453) AUTHORS Barth KA and Wilson SW. TITLE Expression of zebrafish nk2.2 is influenced by sonic hedgehog/vertebrate hedgehog-1 and demarcates a zone of neuronal differentiation in the embryonic forebrain JOURNAL Development 121 (6), 1755-1768 (1995) PUBMED 7600991 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF030284.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF030284.1, BC164106.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support SAMEA2168448, SAMEA3505370 [ECO:0000350] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1453 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="7" /map="7" gene 1..1453 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="developing brain homeobox 1a" /db_xref="GeneID:30394" /db_xref="ZFIN:ZDB-GENE-000128-8" exon 1..443 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /inference="alignment:Splign:2.1.0" CDS 95..1039 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="homeobox protein hlx1; developing brain homeobox protein 1-A; H2.0-like homeobox 1" /codon_start=1 /product="homeobox protein DBX1-A" /protein_id="NP_571233.1" /db_xref="GeneID:30394" /db_xref="ZFIN:ZDB-GENE-000128-8" /translation="
MMIPSVIAPPAIYSAFMRPAASLHSPFPAHPSFLVEDLLRINRPSGFLSQTAHSPCASPPNSTPLSIPDNCRILDRVSPGITEKHGPCSPKTPVSSKDPTYLKFGVSAILAPSPKKATSPPSVHSIHPKGFSVPYFDGSFCPFVRSSYFPAPSSVVPIPGTFSWPLAARGKPRRGMLRRAVFSDVQRKALEKMFQKQKYISKPDRKKLAAKLGLKDSQVKIWFQNRRMKWRNSKERELLSSGGCREQTLPTKTNPHPDLSDVGKKSSEDEDEDDACAPSHFCLSPRRVMSNSTDSSITFKHSDFSESEDEITVS"
misc_feature order(626..634,638..640,689..691,707..709,746..748, 752..757,764..769,773..781,785..790) /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 626..787 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(626..628,635..637,755..757,764..769,776..778) /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 794..931 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="propagated from UniProtKB/Swiss-Prot (Q9PTU1.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 968..1036 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /note="propagated from UniProtKB/Swiss-Prot (Q9PTU1.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 444..545 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /inference="alignment:Splign:2.1.0" exon 546..748 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /inference="alignment:Splign:2.1.0" exon 749..1426 /gene="dbx1a" /gene_synonym="fc15c04; hlx-1; hlx1; wu:fc15c04; zgc:109861" /inference="alignment:Splign:2.1.0" ORIGIN
agcaaatcgtcattcggtcagttcagagcttgccaggagagacttgtgtaatactaacaggagtcatttaagtcatcttttaatagccgggaccatgatgatcccaagtgttattgcaccacctgctatatattcagcatttatgcgtcctgctgcatcgctgcattcaccctttccagctcacccgagcttcctggtggaggaccttctgcgcatcaacagacccagcggtttcctgagccaaaccgcgcactctccatgcgcatctcctccaaattcaacgcctctttccatcccggataactgcaggattttggacagagttagccctggcatcacggaaaagcatggaccttgctcccccaaaacgccagtctccagcaaggatccaacatatttaaagtttggagtgagtgccattttggcaccgtcaccaaagaaagccacatctccaccctccgtccacagcatacaccctaaaggattctctgtgccttattttgatggttcattctgccctttcgtccgttcttcatacttccctgctccttcatcggtcgtgcccattcctggaactttttcctggcctcttgctgcgagagggaagcccagaagagggatgctccgccgggctgtgttttcagatgtgcagcgcaaagctctggagaaaatgttccaaaagcaaaaatacatcagcaagccagaccggaaaaaacttgcagccaaactcggactaaaagattcacaggtcaaaatctggttccagaatcggcgaatgaaatggagaaactccaaggagagggagttgctttcatccggaggctgccgggagcaaaccctgccaaccaaaacaaaccctcacccagacctaagcgacgtgggtaaaaagtcttccgaagatgaagatgaagacgacgcatgcgctccatcgcatttctgtctctcacccagacgcgtaatgtcaaacagcactgattccagcattacatttaaacactcggacttttctgaatcagaggatgaaataacagtctcataagcaaattcatgagctgcataatgtctgtatttcaagcacaacgttatgttcaaccacgttatggttccactggcgtataatttcacttctatgtacaaatgagtgtttgtagcaaaatcttttccacatcactttatatttacttatttggaaaacctcgcaaaatgattttgctgtgtcgcacagctttttgtggggaactgtacagtattttgtacaaatatttttgtatggatattttataccaagaattttgagttttagattctttattaaagttgtagacgtatgtataatttatacgaatttatcccttcgtgccacattgtatgcatatgtatatgttgaaaatgttttgtattgtttgcaaataaattgtaaatttaaagaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]