2024-05-15 09:42:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001328159 1425 bp mRNA linear VRT 30-SEP-2023 DEFINITION Danio rerio homeobox C6b (hoxc6b), transcript variant 2, mRNA. ACCESSION NM_001328159 VERSION NM_001328159.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1425) AUTHORS Mukaigasa K, Sakuma C and Yaginuma H. TITLE The developmental hourglass model is applicable to the spinal cord based on single-cell transcriptomes and non-conserved cis-regulatory elements JOURNAL Dev Growth Differ 63 (7), 372-391 (2021) PUBMED 34473348 REFERENCE 2 (bases 1 to 1425) AUTHORS Yamada K, Maeno A, Araki S, Kikuchi M, Suzuki M, Ishizaka M, Satoh K, Akama K, Kawabe Y, Suzuki K, Kobayashi D, Hamano N and Kawamura A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 3 (bases 1 to 1425) AUTHORS Malmstrom M, Britz R, Matschiner M, Torresen OK, Hadiaty RK, Yaakob N, Tan HH, Jakobsen KS, Salzburger W and Ruber L. TITLE The Most Developmentally Truncated Fishes Show Extensive Hox Gene Loss and Miniaturized Genomes JOURNAL Genome Biol Evol 10 (4), 1088-1103 (2018) PUBMED 29684203 REFERENCE 4 (bases 1 to 1425) AUTHORS Barsh GR, Isabella AJ and Moens CB. TITLE Vagus Motor Neuron Topographic Map Determined by Parallel Mechanisms of hox5 Expression and Time of Axon Initiation JOURNAL Curr Biol 27 (24), 3812-3825 (2017) PUBMED 29225029 REFERENCE 5 (bases 1 to 1425) AUTHORS Nakayama Y, Inomata C, Yuikawa T, Tsuda S and Yamasu K. TITLE Comprehensive analysis of target genes in zebrafish embryos reveals gbx2 involvement in neurogenesis JOURNAL Dev Biol 430 (1), 237-248 (2017) PUBMED 28756106 REFERENCE 6 (bases 1 to 1425) AUTHORS Kurosawa G, Takamatsu N, Takahashi M, Sumitomo M, Sanaka E, Yamada K, Nishii K, Matsuda M, Asakawa S, Ishiguro H, Miura K, Kurosawa Y, Shimizu N, Kohara Y and Hori H. TITLE Organization and structure of hox gene loci in medaka genome and comparison with those of pufferfish and zebrafish genomes JOURNAL Gene 370, 75-82 (2006) PUBMED 16472944 REMARK Erratum:[Gene. 2006 Jul;376(2):298-9] REFERENCE 7 (bases 1 to 1425) AUTHORS Corredor-Adamez M, Welten MC, Spaink HP, Jeffery JE, Schoon RT, de Bakker MA, Bagowski CP, Meijer AH, Verbeek FJ and Richardson MK. TITLE Genomic annotation and transcriptome analysis of the zebrafish (Danio rerio) hox complex with description of a novel member, hox b 13a JOURNAL Evol Dev 7 (5), 362-375 (2005) PUBMED 16174031 REFERENCE 8 (bases 1 to 1425) AUTHORS Santini S and Bernardi G. TITLE Organization and base composition of tilapia Hox genes: implications for the evolution of Hox clusters in fish JOURNAL Gene 346, 51-61 (2005) PUBMED 15716008 REFERENCE 9 (bases 1 to 1425) AUTHORS Thummel R, Li L, Tanase C, Sarras MP Jr and Godwin AR. TITLE Differences in expression pattern and function between zebrafish hoxc13 orthologs: recruitment of Hoxc13b into an early embryonic role JOURNAL Dev Biol 274 (2), 318-333 (2004) PUBMED 15385162 REFERENCE 10 (bases 1 to 1425) AUTHORS Yekta S, Shih IH and Bartel DP. TITLE MicroRNA-directed cleavage of HOXB8 mRNA JOURNAL Science 304 (5670), 594-596 (2004) PUBMED 15105502 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CABZ01085067.1. Transcript Variant: This variant (2) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (2) has a shorter and distinct N-terminus compared to isoform 1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CT634685.2 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA4476752 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-169 CABZ01085067.1 26922-27090 c 170-184 CABZ01085067.1 25242-25256 c 185-522 CABZ01085067.1 22500-22837 c 523-1425 CABZ01085067.1 21167-22069 c FEATURES Location/Qualifiers source 1..1425 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="11" /map="11" gene 1..1425 /gene="hoxc6b" /gene_synonym="hoxy6" /note="homeobox C6b" /db_xref="GeneID:58045" /db_xref="ZFIN:ZDB-GENE-000822-1" exon 1..169 /gene="hoxc6b" /gene_synonym="hoxy6" /inference="alignment:Splign:2.1.0" misc_feature 168..170 /gene="hoxc6b" /gene_synonym="hoxy6" /note="upstream in-frame stop codon" exon 170..184 /gene="hoxc6b" /gene_synonym="hoxy6" /inference="alignment:Splign:2.1.0" CDS 180..824 /gene="hoxc6b" /gene_synonym="hoxy6" /note="isoform 2 is encoded by transcript variant 2; homeobox protein Hox-C6b; homeobox gene Y-6; homeo box C6b" /codon_start=1 /product="homeobox protein Hox-C6b isoform 2" /protein_id="NP_001315088.1" /db_xref="GeneID:58045" /db_xref="ZFIN:ZDB-GENE-000822-1" /translation="
MFGQEVLPSVAISSTNYDPVRHFSPYGAAVAQNRIYSNPFYSHQENVMFGSSRPYDYGSNMFYQDKDVLPSCRQGFGQTQGSLTQDYASDQGKTMEPKGSVQIYPWMQRMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHYNRYLTRRRRIEIANTLCLSERQIKIWFQNRRMKWKKESNLTSILNDNGSVGAGQDTDKEETGETAEKDEHD"
misc_feature order(546..560,564..566,615..617,633..635,672..674, 678..683,690..695,699..707,711..716) /gene="hoxc6b" /gene_synonym="hoxy6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(552..554,561..563,681..683,690..695,702..704) /gene="hoxc6b" /gene_synonym="hoxy6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 555..713 /gene="hoxc6b" /gene_synonym="hoxy6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 185..522 /gene="hoxc6b" /gene_synonym="hoxy6" /inference="alignment:Splign:2.1.0" exon 523..1425 /gene="hoxc6b" /gene_synonym="hoxy6" /inference="alignment:Splign:2.1.0" ORIGIN
gtatgtacactaagacgagaacgttgtctttgctgtgaaggaaaaagaaatggatgttcgctttggattaccgcagctaattctgaagctcttgcaattacctcccaccctttcctcaggagctgaagatctctcaaaacgcgtcacaagagaaatgtgttaagatatgatttggaactatgttcggtcaagaagttctacccagcgttgccatcagctcgacaaactatgacccggtgcgacatttttcgccatatggcgccgccgttgcccaaaaccggatatactccaatccgttctattcacaccaagaaaacgttatgtttgggtcaagccgaccgtacgattacggatcaaatatgttctaccaggacaaagatgtgcttccaagttgcaggcaaggctttgggcaaacacagggttcattgacgcaggattacgcttcagaccaaggcaagactatggaaccgaaaggaagtgttcaaatatatccatggatgcagcggatgaactcgcatagtggagttggctatgggtctgacagacggcgaggtcgccaaatctattcgcgataccaaactttagaacttgagaaagaatttcattacaatcgctatttgacaagacgcagacgaattgagattgccaacacattgtgtctgtcggaacgccagattaaaatttggtttcagaaccgccggatgaaatggaagaaggagagcaatctcacgtccatcctcaatgacaatggctcggtaggagctggccaagacacggacaaagaagaaacaggggaaaccgccgaaaaagatgagcatgactgattgacttactaactaattaaaagacattccgtttgaaaacgttcttacataactaagctacctatggaatttacacaatttgcacaattaaaaccaaaaactgttacaattcctttagatgcaaagcgtgtgttgcttcgccacttatttcactatgattctgaaaagctgtttatccagagcaatttaattcataaatcagtgctctgactgaaaatgttttacctatcttgtgtgatttaatcttgtcattaaacatcttatttgttctgatgtactctgaagtgcaaataagggactgttgatgtagaccaaatatgaaaattccaaatattaaactacaatcatttcttctggtcctaggaagtgcattgtacatgtttgtaaatatgagattcaaatacttttgatgagcatttgtttagattgacgtactgttttgtgttttttctttactttgtgatgcgttctgggagaaccacatacgttgtaaaaagtatccttcattactctttttttccaaatgttgaattttagcaaaaaagcaagataataaaatgttcgaacatttacgcaataaagttgtaatcaatataacaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]