2024-05-15 11:12:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001122706 663 bp mRNA linear VRT 28-DEC-2020 DEFINITION Danio rerio claudin 26 (cldn26), mRNA. ACCESSION NM_001122706 XM_001332797 VERSION NM_001122706.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 663) AUTHORS Baltzegar DA, Reading BJ, Brune ES and Borski RJ. TITLE Phylogenetic revision of the claudin gene family JOURNAL Mar Genomics 11, 17-26 (2013) PUBMED 23726886 COMMENT PREDICTED REFSEQ: This record has not been reviewed and the function is unknown. The reference sequence was derived from CT737234.14. On Mar 17, 2008 this sequence version replaced XM_001332797.1. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-663 CT737234.14 36784-37446 c FEATURES Location/Qualifiers source 1..663 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="5" /map="5" gene 1..663 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /note="claudin 26" /db_xref="GeneID:793143" /db_xref="ZFIN:ZDB-GENE-060526-352" CDS 1..663 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /codon_start=1 /product="uncharacterized protein LOC793143" /protein_id="NP_001116178.1" /db_xref="GeneID:793143" /db_xref="ZFIN:ZDB-GENE-060526-352" /translation="
MVLFTTKFVQRASLFVSFGGLVTTFVTTFLPLWKTMNSDLNEMENWYEGLWHMCIYTEEVGIHCKAFDSFLALPPDTFAGRVLMCISIATGILGVAAAFFGLRGVEIGASRERMKRNLLILGGVFVVVSGVTTLAAVSFMAYVMVVKFWDDDRPEVMPGWEYGEAMFSAWFAGLLLVVGGSFLFVAVCMGDHEVKLQTEMIARCQEQRPRSLHYRKTEII"
misc_feature 40..549 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" exon 1..663 /gene="cldn26" /gene_synonym="cldn25-like; si:dkey-98f17.3" /inference="alignment:Splign:2.1.0" ORIGIN
atggtgctgttcaccaccaagtttgtccagagggcttcgctctttgtgtccttcggaggtttggtcacaacgttcgtcacaaccttcttgcccctatggaagacgatgaactccgatttgaatgaaatggagaactggtacgagggtctctggcacatgtgtatctacacggaggaagttggcatccattgcaaagcctttgattctttcttagctcttccgccggacactttcgctggccgggttctcatgtgcatttccatcgccactggaattctcggtgtggcggctgcttttttcggactccgcggagttgagattggcgccagtcgagagaggatgaagaggaatctgctgatcctcgggggagtttttgtagttgtgtctggagtcacgactcttgcggctgtttcatttatggcgtatgttatggttgtgaaattctgggatgatgatcgtcctgaagtcatgcccggatgggagtatggagaagccatgttttctgcctggtttgctggacttctgttagttgtcggagggagttttttgtttgttgcagtctgcatgggcgatcatgaagtgaagctgcaaactgaaatgattgcacgctgtcaagaacagcggccgagatctctgcattaccgaaagacggaaatcatatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]