2024-05-17 12:31:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026836773 534 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis cytochrome P450 2L1-like (LOC113474702), mRNA. ACCESSION XM_026836773 VERSION XM_026836773.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq; includes ab initio. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020176.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..534 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="11" gene 1..534 /gene="LOC113474702" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:113474702" CDS 1..534 /gene="LOC113474702" /codon_start=1 /product="cytochrome P450 2L1-like" /protein_id="XP_026692574.1" /db_xref="GeneID:113474702" /translation="
MYDWQIIATYYSGEELPRLDHKDELPLLQAFIQELYRCMALIPLGIQHQTTKNVDICGYCIPKDTVVFTNIHAVHHDPNIWKNPSEFNIYRHIDEEGKFIPSRKVIPFGIGCRSCLGEKLARIEIFLFLANIIKRFEVRPDPDSEPLLPIDDGITGFGFLPFLFKAVVLPRTNKGTQ"
misc_feature <46..495 /gene="LOC113474702" /note="cytochrome P450 (CYP) superfamily; Region: cytochrome_P450; cl41757" /db_xref="CDD:425388" ORIGIN
atgtatgactggcaaataattgcaacttattattcaggtgaagaacttccaaggttggaccacaaggatgagcttccattactccaagcctttatacaagaactttaccgctgtatggcccttataccactaggtattcaacaccaaactacgaagaatgtggatatttgtggatactgtatacccaaagatacagtggtatttacgaacatccacgctgtgcaccacgatccaaatatctggaaaaatccgagcgagttcaacatttatcgccatatcgacgaagagggaaagttcattccttccagaaaagtgattccgtttggaatcggatgcagatcctgtcttggtgagaagttagcaagaattgagattttcctcttccttgccaacatcatcaaaaggttcgaggtccgtcctgatcctgatagcgaacctcttcttccaatagacgatggaatcactggttttggttttttgccctttctcttcaaagctgtggttcttccacgtacaaataaaggaactcagtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]