2024-05-17 11:15:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_002131669 484 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis 60S ribosomal protein L35 (LOC100179536), mRNA. ACCESSION XM_002131669 VERSION XM_002131669.5 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020174.2) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_002131669.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..484 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="9" gene 1..484 /gene="LOC100179536" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 672 ESTs, 29 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 228 samples with support for all annotated introns" /db_xref="GeneID:100179536" CDS 86..457 /gene="LOC100179536" /codon_start=1 /product="60S ribosomal protein L35" /protein_id="XP_002131705.1" /db_xref="GeneID:100179536" /translation="
MARIKAKELRGKSKDELLKQLNDFKQELSTLRVAKVTGGAASKLSKICLVRKSIARVLTVINQTQKDNLRKLFKGKKHKPKDLRPKKTRALRRRLNKHEESLKSVKALKKARLYPQRQFAIKA"
misc_feature 104..274 /gene="LOC100179536" /note="Ribosomal L29 protein; Region: Ribosomal_L29; pfam00831" /db_xref="CDD:425893" misc_feature order(104..106,113..115,218..220,248..253,257..262, 272..274) /gene="LOC100179536" /note="23S rRNA interface [nucleotide binding]; other site" /db_xref="CDD:238243" misc_feature order(104..112,116..118,128..133,137..142,149..154, 161..166,173..175,182..187,212..214,221..223,233..235, 242..247,254..259,266..268) /gene="LOC100179536" /note="putative translocon interaction site [active]" /db_xref="CDD:238243" misc_feature order(152..154,164..166,173..175,185..187,233..235) /gene="LOC100179536" /note="signal recognition particle (SRP54) interaction site [active]" /db_xref="CDD:238243" misc_feature order(170..172,179..184) /gene="LOC100179536" /note="L23 interface [polypeptide binding]; other site" /db_xref="CDD:238243" misc_feature 191..196 /gene="LOC100179536" /note="trigger factor interaction site [active]" /db_xref="CDD:238243" ORIGIN
tttataaaaaggaaacactgttgcggattcattggtttgttggcgaggtttggaaccttggctccttttgaattgaagtcttgaaatggctcgtatcaaagccaaggaactgcgtggaaagtcgaaggacgagctgcttaagcagctaaacgacttcaagcaggaattatctaccctgcgggttgcgaaagtgaccggaggagccgcatcaaagctctcaaaaatatgcttggtccgcaaaagcatcgctcgtgtcctcacggtcattaaccagactcaaaaggataacttgaggaaattgtttaagggaaagaaacataagcctaaggatttacgaccgaaaaagaccagagccctgcgtcgtcgtttaaacaaacatgaagaaagtttaaaatccgtaaaagctttgaaaaaagcaagactctacccacagcgacagtttgcaatcaaggcataaggttctaataaaccatttcgggatata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]