GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-06-01 15:55:06, GGRNA.v2 : RefSeq release 223 (Mar, 2024)

LOCUS       XM_002127353             935 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis uncharacterized oxidoreductase
            TM_0325-like (LOC100181369), mRNA.
ACCESSION   XM_002127353
VERSION     XM_002127353.5
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020173.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_002127353.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..935
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="8"
     gene            1..935
                     /gene="LOC100181369"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 30 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     100 samples with support for all annotated introns"
                     /db_xref="GeneID:100181369"
     CDS             91..852
                     /gene="LOC100181369"
                     /codon_start=1
                     /product="uncharacterized protein LOC100181369"
                     /protein_id="XP_002127389.1"
                     /db_xref="GeneID:100181369"
                     /translation="
MAAGKRVVLVTGSSRGIGAETAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMDLLMNETIKTFGQLDVLVNNAGIVLFKDIEEYTSEDFDKVFSINVKAPIYLTKIARPYLSKTKGNIVNLCSVARETYARNFLVYGMAKISIAHLTKTIAADFTKYGIRCNAVCPGVVETDIYEGTIPTDRMRKIIGYNITKLRNRLTTKSDVSDLIRFLASDKATMITGELITIDGGRSLL"
     misc_feature    106..849
                     /gene="LOC100181369"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl21454"
                     /db_xref="CDD:451247"
     misc_feature    order(124..126,130..135,139..141,196..198,205..210,
                     364..372,511..519,556..558,568..570,646..657)
                     /gene="LOC100181369"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(436..438,517..519,556..558,568..570)
                     /gene="LOC100181369"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
ttcattcggaacgaataaagttgtctgtgctgtgacgtatgtctcgctcaaatcgaaaacctgctcagtcacgctgtgttgttattcaatatggctgcggggaaacgggttgttcttgtaaccggcagttcgaggggaatcggagccgaaactgctaaaggatttgcaaaggaaggagcctcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcaaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctaagaaaacaagaagatatggatttgttgatgaatgaaacgatcaagacgtttggacaacttgatgtcttggttaacaacgcaggaatcgtattgttcaaagatatagaagagtacaccagtgaagatttcgataaagtgttcagcattaatgttaaagcgccaatctatctaaccaagattgcaaggccatacctcagcaaaactaaaggaaacatcgtcaacttgtgcagcgttgcgagagagacatacgctcgcaatttccttgtgtatgggatggcaaaaatatcaattgcccatctaactaaaaccattgcggcagattttaccaagtatggaatacgttgtaacgccgtgtgtccgggcgttgtagaaactgatatatacgaaggcacaatacctacagatcgcatgcgtaagatcatcggctacaacataactaaactgaggaatcgactcacaaccaaaagtgatgtttcagacctcataaggttccttgcttcagataaggcgaccatgatcactggagagttgattactattgacgggggacgatctttactttaatgttcagtatgcgaactcaatatttatacggattaaatatatttgcatttaatttaatgtccgcaataaaatattttggaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]