2024-06-01 15:55:06, GGRNA.v2 : RefSeq release 223 (Mar, 2024)
LOCUS XM_002127353 935 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis uncharacterized oxidoreductase TM_0325-like (LOC100181369), mRNA. ACCESSION XM_002127353 VERSION XM_002127353.5 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020173.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_002127353.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..935 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="8" gene 1..935 /gene="LOC100181369" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 30 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 100 samples with support for all annotated introns" /db_xref="GeneID:100181369" CDS 91..852 /gene="LOC100181369" /codon_start=1 /product="uncharacterized protein LOC100181369" /protein_id="XP_002127389.1" /db_xref="GeneID:100181369" /translation="
MAAGKRVVLVTGSSRGIGAETAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMDLLMNETIKTFGQLDVLVNNAGIVLFKDIEEYTSEDFDKVFSINVKAPIYLTKIARPYLSKTKGNIVNLCSVARETYARNFLVYGMAKISIAHLTKTIAADFTKYGIRCNAVCPGVVETDIYEGTIPTDRMRKIIGYNITKLRNRLTTKSDVSDLIRFLASDKATMITGELITIDGGRSLL"
misc_feature 106..849 /gene="LOC100181369" /note="Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl21454" /db_xref="CDD:451247" misc_feature order(124..126,130..135,139..141,196..198,205..210, 364..372,511..519,556..558,568..570,646..657) /gene="LOC100181369" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(436..438,517..519,556..558,568..570) /gene="LOC100181369" /note="active site" /db_xref="CDD:187535" ORIGIN
ttcattcggaacgaataaagttgtctgtgctgtgacgtatgtctcgctcaaatcgaaaacctgctcagtcacgctgtgttgttattcaatatggctgcggggaaacgggttgttcttgtaaccggcagttcgaggggaatcggagccgaaactgctaaaggatttgcaaaggaaggagcctcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcaaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctaagaaaacaagaagatatggatttgttgatgaatgaaacgatcaagacgtttggacaacttgatgtcttggttaacaacgcaggaatcgtattgttcaaagatatagaagagtacaccagtgaagatttcgataaagtgttcagcattaatgttaaagcgccaatctatctaaccaagattgcaaggccatacctcagcaaaactaaaggaaacatcgtcaacttgtgcagcgttgcgagagagacatacgctcgcaatttccttgtgtatgggatggcaaaaatatcaattgcccatctaactaaaaccattgcggcagattttaccaagtatggaatacgttgtaacgccgtgtgtccgggcgttgtagaaactgatatatacgaaggcacaatacctacagatcgcatgcgtaagatcatcggctacaacataactaaactgaggaatcgactcacaaccaaaagtgatgtttcagacctcataaggttccttgcttcagataaggcgaccatgatcactggagagttgattactattgacgggggacgatctttactttaatgttcagtatgcgaactcaatatttatacggattaaatatatttgcatttaatttaatgtccgcaataaaatattttggaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]