GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 18:40:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_171290                651 bp    mRNA    linear   INV 22-NOV-2023
DEFINITION  Caenorhabditis elegans Protein kinase domain-containing protein
            (Y69A2AR.32), partial mRNA.
ACCESSION   NM_171290
VERSION     NM_171290.6
DBLINK      BioProject: PRJNA158
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 651)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 651)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 651)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2023) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 651)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            
            On Apr 15, 2020 this sequence version replaced NM_171290.5.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..651
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>651
                     /gene="Y69A2AR.32"
                     /locus_tag="CELE_Y69A2AR.32"
                     /db_xref="GeneID:177042"
                     /db_xref="WormBase:WBGene00022101"
     CDS             1..651
                     /gene="Y69A2AR.32"
                     /locus_tag="CELE_Y69A2AR.32"
                     /standard_name="Y69A2AR.32b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Protein kinase domain-containing protein"
                     /protein_id="NP_741341.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00022101"
                     /db_xref="EnsemblGenomes-Tr:Y69A2AR.32b.1"
                     /db_xref="EnsemblGenomes-Tr:Y69A2AR.32b.2"
                     /db_xref="GeneID:177042"
                     /db_xref="GOA:Q8T871"
                     /db_xref="InterPro:IPR036612"
                     /db_xref="UniProtKB/TrEMBL:Q8T871"
                     /db_xref="WormBase:WBGene00022101"
                     /translation="
MAHAVEVIQRLLSPPKDGKDELKRQQLVDISLINGTYRVTSTSNEHVGQFRRPRYSADPTSNSTDLQLRPLDAHGAYGDVGSVYGIAQQKRIWQKPRGPDATSEEFAHSVSSREFVTDIVHKTKNSPRRANDAIFSLTDEIVNDSLKAAQTLLASHELLTFGLQDQQKMMKVTQYGAGDTSSRKNLPYPPPLMSTPMPPPGYSMCYMMPPYYPPRY"
ORIGIN      
atggctcatgccgtggaagtcattcagagattattgtcgccgccgaaagatgggaaggatgagctgaagcgacaacagttggtggatatttcgctgatcaatgggacttatagagttacaagcacatccaatgagcatgttggccaattccgccgtccacgttattcagcggatccgacgtcaaattccacagacttgcagcttcgcccattggatgctcacggagcatatggagatgttggatcagtctacggaatcgcccagcaaaagcgcatttggcagaagccacgtggaccggatgccacgtcagaagagttcgctcactctgtatcctcgcgcgagtttgtcaccgatattgtgcacaagacgaagaatagtccgcgacgagcaaacgacgcgattttcagtctaaccgatgagattgtcaatgactcgttgaaagccgcccaaacactgctcgcctcccatgaattgctcaccttcgggcttcaggatcagcaaaaaatgatgaaagttacgcagtatggagccggtgacaccagcagtcggaaaaatcttccgtatccgccaccactgatgtccactccgatgccgcctccaggatattcaatgtgctatatgatgccgccatattacccaccaagatattga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]