2024-05-18 21:41:59, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001038454 555 bp mRNA linear INV 22-NOV-2023 DEFINITION Caenorhabditis elegans Claudin domain-containing protein 1 (F23G4.1), partial mRNA. ACCESSION NM_001038454 VERSION NM_001038454.3 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 555) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 555) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-NOV-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 555) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (29-OCT-2023) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 555) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003284). On Feb 2, 2021 this sequence version replaced NM_001038454.2. COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..555 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="X" gene <1..>555 /gene="F23G4.1" /locus_tag="CELE_F23G4.1" /db_xref="GeneID:3896878" /db_xref="WormBase:WBGene00044574" CDS 1..555 /gene="F23G4.1" /locus_tag="CELE_F23G4.1" /standard_name="F23G4.1" /note="Partially confirmed by transcript evidence" /codon_start=1 /product="Claudin domain-containing protein 1" /protein_id="NP_001033543.1" /db_xref="EnsemblGenomes-Gn:WBGene00044574" /db_xref="EnsemblGenomes-Tr:F23G4.1" /db_xref="GeneID:3896878" /db_xref="GOA:Q4PIV2" /db_xref="UniProtKB/TrEMBL:Q4PIV2" /db_xref="WormBase:WBGene00044574" /translation="
MAVVPENNVMRYCSLTFTIIGMALTTTSLFTDHWVDVEVKNPKGHDLYLHRGLMQWVCINQKDISDRNCIAKYPLFPGWLKSVFTCMCFGLAMQCLLCMCAIVSLFIKSGKHYLSVVCTALSFTGFLLITVAIGIFGGQAKPVYFETYVYDGLTVFCHLGWSYWLTRECFNYVVRSGKSKRVMR"
ORIGIN
atggctgtagtccctgagaataatgtaatgcgatattgctcgttgacatttacaattattggaatggcactgactactacatccctgttcacagatcattgggtagacgtggaggtaaaaaatccaaaaggacatgacctttatctacaccgaggattaatgcaatgggtttgcataaaccagaaagatataagtgaccgaaactgcattgcaaaatatccactttttcctggttggctcaaatctgtattcacgtgtatgtgctttgggttggccatgcaatgtctcttatgcatgtgcgctatcgtttccttgttcatcaaaagcggaaaacattacctttcggttgtttgcaccgcactatcgttcacaggattcttactgattacggttgcaattggtatttttggaggacaagcgaaaccagtttattttgaaacgtatgtttacgatggtctaacagtattttgccatcttggttggtcatattggcttactagggagtgttttaactatgtggtgcgatcgggtaaaagtaaacgagttatgcgatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]