GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 12:51:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_115864                688 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana SKP1-like 13 (SK13), mRNA.
ACCESSION   NM_115864
VERSION     NM_115864.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 688)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 688)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 688)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 688)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
            
            On Sep 12, 2016 this sequence version replaced NM_115864.1.
FEATURES             Location/Qualifiers
     source          1..688
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..688
                     /gene="SK13"
                     /locus_tag="AT3G60010"
                     /gene_synonym="ASK13; SKP1-like 13; T2O9.1"
                     /db_xref="Araport:AT3G60010"
                     /db_xref="GeneID:825171"
                     /db_xref="TAIR:AT3G60010"
     CDS             44..508
                     /gene="SK13"
                     /locus_tag="AT3G60010"
                     /gene_synonym="ASK13; SKP1-like 13; T2O9.1"
                     /note="SKP1-like 13 (SK13); FUNCTIONS IN:
                     ubiquitin-protein ligase activity, protein binding;
                     INVOLVED IN: ubiquitin-dependent protein catabolic
                     process; LOCATED IN: endomembrane system; EXPRESSED IN: 15
                     plant structures; EXPRESSED DURING: M germinated pollen
                     stage, 4 anthesis, seedling growth, petal differentiation
                     and expansion stage; CONTAINS InterPro DOMAIN/s: E3
                     ubiquitin ligase, SCF complex, Skp subunit
                     (InterPro:IPR016897), SKP1 component, dimerisation
                     (InterPro:IPR016072), SKP1 component (InterPro:IPR001232),
                     BTB/POZ fold (InterPro:IPR011333), SKP1 component, POZ
                     (InterPro:IPR016073); BEST Arabidopsis thaliana protein
                     match is: SKP1-like 11 (TAIR:AT4G34210.1); Has 1418 Blast
                     hits to 1414 proteins in 268 species: Archae - 0; Bacteria
                     - 0; Metazoa - 525; Fungi - 176; Plants - 537; Viruses -
                     11; Other Eukaryotes - 169 (source: NCBI BLink)."
                     /codon_start=1
                     /product="SKP1-like 13"
                     /protein_id="NP_567090.1"
                     /db_xref="GeneID:825171"
                     /db_xref="TAIR:AT3G60010"
                     /db_xref="Araport:AT3G60010"
                     /translation="
MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE"
     misc_feature    53..400
                     /gene="SK13"
                     /locus_tag="AT3G60010"
                     /gene_synonym="ASK13; SKP1-like 13; T2O9.1"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ
                     (poxvirus and zinc finger) domain found in S-phase
                     kinase-associated protein 1 (SKP1) and similar proteins;
                     Region: BTB_POZ_SKP1; cd18322"
                     /db_xref="CDD:349631"
     misc_feature    order(119..124,134..136,146..148,158..163,167..169,
                     173..178,332..334,341..346,350..352)
                     /gene="SK13"
                     /locus_tag="AT3G60010"
                     /gene_synonym="ASK13; SKP1-like 13; T2O9.1"
                     /note="cullin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:349631"
     misc_feature    order(302..304,320..322,332..334,341..343,356..358,
                     368..370,377..382,386..391,398..400)
                     /gene="SK13"
                     /locus_tag="AT3G60010"
                     /gene_synonym="ASK13; SKP1-like 13; T2O9.1"
                     /note="F-box protein binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:349631"
     misc_feature    356..499
                     /gene="SK13"
                     /locus_tag="AT3G60010"
                     /gene_synonym="ASK13; SKP1-like 13; T2O9.1"
                     /note="Skp1 family, dimerization domain; Region: Skp1;
                     pfam01466"
                     /db_xref="CDD:426275"
ORIGIN      
gtaaacaaaaatcgccaccacaaaaagaaaaaagaaggaaacgatgtcgaagatggttatgttgctgagctccgatggtgaatctttccaggtcgaagaagcagtcgcggtccagtcacagacgatagcacatatgattgaagacgattgcgtcgccaatggagtccctatcgcaaacgttacaggagtcatcctctcgaaggtgatcgagtattgcaagaaacacgtcgtttctgattcaccaaccgaagagagcaaagacgaactcaagaagtgggacgctgagttcatgaaggccctggaacagtcgtcgactctctttgatgttatgctggctgcgaattacctaaacataaaagacctgcttgaccttggttgccaaactgttgctgacatgatcactggcaagaaaccagacgagattcgtgcacttcttggcatcgagaacgattttacaccggaggaggaagaggagattcgtaaggagaatcaatgggcttttgaatgattctttagttttctttttcgacgttagtgtgctttctgatcttctttatcaagatcaatgtctcgtgttcttttttctttagtttgtttccgatctcttgaacagtgtcttttgttctttcttctcttgtgtgtatgtgtgttttcttgatcaatgtgacttcgttattgtcttttctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]