2024-05-18 16:28:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_114963 704 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana thioredoxin H-type 1 (TRX1), mRNA. ACCESSION NM_114963 VERSION NM_114963.5 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 704) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M., Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B., Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P., Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V., Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S., Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P., Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S., Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H., Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M., Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A., Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C., Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P., Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M., Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S., Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L., Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A., Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B., Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J., Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X., Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M., Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S., Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M. and Tabata,S. CONSRTM European Union Chromosome 3 Arabidopsis Sequencing Consortium; Institute for Genomic Research; Kazusa DNA Research Institute TITLE Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 820-822 (2000) PUBMED 11130713 REFERENCE 2 (bases 1 to 704) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 704) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 704) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003074). On Sep 12, 2016 this sequence version replaced NM_114963.4. FEATURES Location/Qualifiers source 1..704 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="3" /ecotype="Columbia" gene 1..704 /gene="TRX1" /locus_tag="AT3G51030" /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1; ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1" /note="encodes a cytosolic thioredoxin that reduces disulfide bridges of target proteins by the reversible formation of a disulfide bridge between two neighboring Cys residues present in the active site. Thioredoxins have been found to regulate a variety of biological reactions in prokaryotic and eukaryotic cells." /db_xref="Araport:AT3G51030" /db_xref="GeneID:824267" /db_xref="TAIR:AT3G51030" CDS 155..499 /gene="TRX1" /locus_tag="AT3G51030" /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1; ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1" /inference="Similar to RNA sequence, EST:INSD:DR322271.1,INSD:EH881320.1,INSD:ES051740.1, INSD:DR371494.1,INSD:DR301300.1,INSD:DR322273.1, INSD:DR374664.1,INSD:DR224540.1,INSD:DR322270.1, INSD:DR322272.1,INSD:DR322269.1" /inference="Similar to RNA sequence, mRNA:INSD:AY088687.1,INSD:BX842165.1,INSD:Z14084.1" /note="thioredoxin H-type 1 (TRX1); FUNCTIONS IN: oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor; INVOLVED IN: cell redox homeostasis; LOCATED IN: cytosol; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS InterPro DOMAIN/s: Thioredoxin fold (InterPro:IPR012335), Thioredoxin, core (InterPro:IPR015467), Thioredoxin domain (InterPro:IPR013766), Thioredoxin, conserved site (InterPro:IPR017937), Thioredoxin-like subdomain (InterPro:IPR006662), Thioredoxin-like (InterPro:IPR017936), Thioredoxin-like fold (InterPro:IPR012336); BEST Arabidopsis thaliana protein match is: thioredoxin H-type 5 (TAIR:AT1G45145.1); Has 18017 Blast hits to 17697 proteins in 2965 species: Archae - 232; Bacteria - 9905; Metazoa - 1876; Fungi - 909; Plants - 1960; Viruses - 5; Other Eukaryotes - 3130 (source: NCBI BLink)." /codon_start=1 /product="thioredoxin H-type 1" /protein_id="NP_190672.1" /db_xref="GeneID:824267" /db_xref="TAIR:AT3G51030" /db_xref="Araport:AT3G51030" /translation="
MASEEGQVIACHTVETWNEQLQKANESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAKHLA"
misc_feature 209..484 /gene="TRX1" /locus_tag="AT3G51030" /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1; ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1" /note="TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox...; Region: TRX_family; cd02947" /db_xref="CDD:239245" misc_feature order(272..274,281..283) /gene="TRX1" /locus_tag="AT3G51030" /gene_synonym="ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1; ATTRX H1; ATTRX1; THIOREDOXIN; thioredoxin H-type 1" /note="catalytic residues [active]" /db_xref="CDD:239245" ORIGIN
aattatgggaaacaaaatcacgcgtcgaataaagtagaagagaaaaactattgacgggcaaaattgggattggtaggtgacgcgcatgctaagtaattgaaaaaaaaaaaacacaagaggagaagaaacagaacagagaagaaaaagagagaagatggcttcggaagaaggacaagtgatcgcctgccacaccgttgagacatggaacgagcagcttcagaaggctaatgaatccaaaactcttgtggtggttgatttcacggcttcttggtgtggaccatgtcgtttcatcgctccattctttgctgatttggctaagaaacttcctaacgtgcttttcctcaaggttgatactgatgaattgaagtcggtggcaagtgattgggcgatacaggcgatgccaaccttcatgtttttgaaggaagggaagattttggacaaagttgttggagccaagaaagatgagcttcagtctaccattgccaaacacttggcttaagctttccactcttatatatctcttaagatgttggattaattgttctattactcttgacatgttataacttgttcccctttgttatggttccggtctataatctcatctgactatttgaagctgaaaattgctttgcttatccagtaaatcaattactttgtgacttcaaagtatatttgaaaactaatttctacattatgtcctc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]