GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 16:28:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001331584             657 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana Rab GTPase-like A5A protein (RABA5E), partial
            mRNA.
ACCESSION   NM_001331584
VERSION     NM_001331584.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 657)
  AUTHORS   Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
            White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
            Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
            Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
            Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
            Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
            Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
            Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
            Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
            Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
            Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
            Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
            Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
            Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
            Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
            Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
            Fraser,C.M., Venter,J.C. and Davis,R.W.
  TITLE     Sequence and analysis of chromosome 1 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 816-820 (2000)
   PUBMED   11130712
REFERENCE   2  (bases 1 to 657)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 657)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 657)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 657)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003070).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="1"
                     /ecotype="Columbia"
     gene            <1..>657
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /db_xref="Araport:AT1G05810"
                     /db_xref="GeneID:837091"
                     /db_xref="TAIR:AT1G05810"
     CDS             1..657
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /inference="Similar to RNA sequence,
                     EST:INSD:CK119916.1,INSD:EH980842.1,INSD:AV789625.1,
                     INSD:BP575803.1,INSD:CB261341.1,INSD:BP596412.1,
                     INSD:DR287737.1,INSD:AV825056.1,INSD:BP615697.1,
                     INSD:BP611642.1,INSD:EH800885.1,INSD:BP781765.1,
                     INSD:EH865612.1"
                     /inference="similar to RNA sequence,
                     mRNA:INSD:BT006190.1,INSD:AY063847.1,INSD:AF332457.1"
                     /note="RAB GTPase homolog A5E (RABA5E); FUNCTIONS IN: GTP
                     binding; INVOLVED IN: protein transport, small GTPase
                     mediated signal transduction; LOCATED IN: chloroplast;
                     EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
                     growth stages; CONTAINS InterPro DOMAIN/s: Ras GTPase
                     (InterPro:IPR001806), Small GTP-binding protein
                     (InterPro:IPR005225), Small GTPase (InterPro:IPR020851),
                     Ras (InterPro:IPR013753), Ras small GTPase, Rab type
                     (InterPro:IPR003579), Rab11-related (InterPro:IPR015595);
                     BEST Arabidopsis thaliana protein match is: RAB GTPase
                     homolog A5D (TAIR:AT2G31680.1); Has 27587 Blast hits to
                     27548 proteins in 749 species: Archae - 23; Bacteria -
                     136; Metazoa - 14522; Fungi - 3761; Plants - 3260; Viruses
                     - 20; Other Eukaryotes - 5865 (source: NCBI BLink)."
                     /codon_start=1
                     /product="Rab GTPase-like A5A protein"
                     /protein_id="NP_001318930.1"
                     /db_xref="Araport:AT1G05810"
                     /db_xref="GeneID:837091"
                     /db_xref="TAIR:AT1G05810"
                     /translation="
MSSDDEGREEYLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLENIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDELTVNRVSLVKDDNSASKQSSGFSCCSST"
     misc_feature    28..522
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab GTPase family 11 (Rab11)-like includes Rab11a,
                     Rab11b, and Rab25; Region: Rab11_like; cd01868"
                     /db_xref="CDD:206660"
     misc_feature    28..42
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab subfamily motif 1 (RabSF1); other site"
                     /db_xref="CDD:206660"
     misc_feature    55..78
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="G1 box; other site"
                     /db_xref="CDD:206660"
     misc_feature    order(61..81,112..114,121..123,130..132,208..210,373..378,
                     382..384,463..471)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206660"
     misc_feature    order(79..114,118..129)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab subfamily motif 2 (RabSF2); other site"
                     /db_xref="CDD:206660"
     misc_feature    order(109..111,124..150)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206660"
     misc_feature    order(124..126,136..159,178..180,184..186)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206660"
     misc_feature    130..132
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="G2 box; other site"
                     /db_xref="CDD:206660"
     misc_feature    order(133..135,139..147,190..192,196..198,217..222,
                     229..231,241..243,247..258,517..519)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:206660"
     misc_feature    order(133..138,142..144,196..201,220..222,226..228,
                     232..240)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="putative GDI interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206660"
     misc_feature    133..147
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab family motif 1 (RabF1); other site"
                     /db_xref="CDD:206660"
     misc_feature    184..198
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab family motif 2 (RabF2); other site"
                     /db_xref="CDD:206660"
     misc_feature    199..210
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="G3 box; other site"
                     /db_xref="CDD:206660"
     misc_feature    order(208..210,214..246)
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206660"
     misc_feature    217..234
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab family motif 3 (RabF3); other site"
                     /db_xref="CDD:206660"
     misc_feature    241..255
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab family motif 4 (RabF4); other site"
                     /db_xref="CDD:206660"
     misc_feature    268..285
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab family motif 5 (RabF5); other site"
                     /db_xref="CDD:206660"
     misc_feature    352..366
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab subfamily motif 3 (RabSF3); other site"
                     /db_xref="CDD:206660"
     misc_feature    373..384
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="G4 box; other site"
                     /db_xref="CDD:206660"
     misc_feature    463..471
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="G5 box; other site"
                     /db_xref="CDD:206660"
     misc_feature    511..522
                     /gene="RABA5E"
                     /locus_tag="AT1G05810"
                     /gene_synonym="ARA; ARA-1; ARABIDOPSIS THALIANA RAB GTPASE
                     HOMOLOG A5E; ATRAB11D; ATRABA5E; RAB GTPase homolog A5E;
                     T20M3.8; T20M3_8"
                     /note="Rab subfamily motif 4 (RabSF4); other site"
                     /db_xref="CDD:206660"
ORIGIN      
atgtcttcggacgacgaaggaagagaggagtatctcttcaagattgttgttatcggcgactctgccgtcggtaaatctaatcttctatctcgttacgcacgtaacgagttcagcgctaactccaaggcgacgatcggagtcgagtttcagacgcagagcatggagattgaaggtaaagaggtcaaggctcagatttgggacactgctggtcaggagcgtttccgtgccgtcacttccgcttattaccgtggcgctgtcggtgccctcgtcgtttacgacattacccgccgcaccactttcgaaagcgttggacgttggctcgatgagcttaagatccattcggatacgacggtggcgagaatgctggtggggaacaagtgtgatctagaaaacataagagcagtgagcgtggaggaaggaaaggctctagccgaagaggaaggactcttctttgtggaaacatcggctcttgattcgactaatgttaaaacagctttcgagatggtgatacttgatatctacaataacgtgagccgtaagcaactcaactcagatacttataaagacgaactcaccgtgaatcgggtaagtcttgttaaggatgataactctgcctccaaacaaagctctggtttctcttgttgttcttccacttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]