2024-05-18 17:14:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001203022 973 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana ADP-ribosylation factor C1 (ARFC1), mRNA. ACCESSION NM_001203022 VERSION NM_001203022.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 973) AUTHORS Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M., Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B., Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P., Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V., Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S., Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P., Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S., Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H., Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M., Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A., Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C., Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P., Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M., Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S., Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L., Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A., Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B., Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J., Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X., Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M., Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S., Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M. and Tabata,S. CONSRTM European Union Chromosome 3 Arabidopsis Sequencing Consortium; Institute for Genomic Research; Kazusa DNA Research Institute TITLE Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 820-822 (2000) PUBMED 11130713 REFERENCE 2 (bases 1 to 973) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 973) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 973) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003074). FEATURES Location/Qualifiers source 1..973 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="3" /ecotype="Columbia" gene 1..973 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="A member of ARF GTPase family. A thaliana has 21 members of this family, known to be essential for vesicle coating and uncoating and functions in GTP-binding. Gene encoding ADP-ribosylation factor and similar to ADP-ribosylation factor GB:P91924 (Dugesia japonica), other ARFs and ARF-like proteins." /db_xref="Araport:AT3G22950" /db_xref="GeneID:821868" /db_xref="TAIR:AT3G22950" CDS 239..790 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="ADP-ribosylation factor C1 (ARFC1); FUNCTIONS IN: GTP binding; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: endomembrane system, intracellular; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: ADP-ribosylation factor (InterPro:IPR006688), Small GTP-binding protein (InterPro:IPR005225), ARF/SAR superfamily (InterPro:IPR006689); BEST Arabidopsis thaliana protein match is: ADP-ribosylation factor 1 (TAIR:AT1G23490.1)." /codon_start=1 /product="ADP-ribosylation factor C1" /protein_id="NP_001189951.1" /db_xref="GeneID:821868" /db_xref="TAIR:AT3G22950" /db_xref="Araport:AT3G22950" /translation="
MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWATYYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCAVTGEGLYDGLGWIAQKVTGKATS"
misc_feature 245..766 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="Arf-like 5 (Arl5) and 8 (Arl8) GTPases; Region: Arl5_Arl8; cd04153" /db_xref="CDD:133353" misc_feature 308..331 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G1 box; other site" /db_xref="CDD:133353" misc_feature order(314..334,614..619,623..625,713..718) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:133353" misc_feature order(314..319,329..331,341..343,377..400,464..466, 479..481) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="putative GAP interaction site [polypeptide binding]; other site" /db_xref="CDD:133353" misc_feature 344..391 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="Switch I region; other site" /db_xref="CDD:133353" misc_feature order(380..394,407..409,437..439,449..451,467..469, 473..481) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="putative GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:133353" misc_feature 380..382 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G2 box; other site" /db_xref="CDD:133353" misc_feature order(383..406,434..436,467..469,476..481) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="putative effector interaction site [active]" /db_xref="CDD:133353" misc_feature order(392..412,419..436) /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="interswitch region [active]" /db_xref="CDD:133353" misc_feature 437..490 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="Switch II region; other site" /db_xref="CDD:133353" misc_feature 437..448 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G3 box; other site" /db_xref="CDD:133353" misc_feature 614..625 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G4 box; other site" /db_xref="CDD:133353" misc_feature 713..721 /gene="ARFC1" /locus_tag="AT3G22950" /gene_synonym="ADP-ribosylation factor C1; ATARFC1" /note="G5 box; other site" /db_xref="CDD:133353" ORIGIN
cgtctttggcgtcgtggctaatggcggtgacgtgttcggtgccattacggtagaggctgcagccgtttggttttgacattgtttcccgcatacttttcttcttcttcttctctccacccatctgctttaaggaaggaacctcaaaagcttacaaaatagtagaagaagaactttttttgatctccgattcttacctctgcaatcttcagattctagctgattcaagaaattggaggagatgggagcattcatgtcgaggttttggttcatgatgtttcctgcaaaagagtataagattgttgttgttggtttggataatgctggtaaaacgacgacgctttataaacttcatttgggtgaagttgttactactcatcctactgttggtagcaatgttgaagagcttgtctacaagaatattcgctttgaggtatgggatcttggtgggcaagataggctaagaacttcatgggcaacatactatcgtggaacacatgctgtgattgtggttatagatagcacagacagagccagaatctctttcatgaaagatgagctagccaggttacttggtcatgaggatcttcaaaactcggtcatactagtttttgcaaacaaacaggatctgaaagacgcaatgactcctgctgagatcacggatgcacttaaccttcacagtatcaagaaccatgattggcatattcaagcaagttgtgcggttactggagaaggattgtatgatgggctcggttggattgcccaaaaagttaccggtaaagccacgagttaaggggaaaccagaactgaatcagagagagtacgtactattcttctttgtttcttttgtctccttcatatgttctttaacattgtatcctcttgacttttatgtaacaagcttcaactattttggttgctctcattgaaactgtgtccagaattttcatatatggaagaaaaaaatcttgttttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]