GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 18:36:56, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_048656001             618 bp    mRNA    linear   INV 11-JUN-2022
DEFINITION  PREDICTED: Athalia rosae involucrin-like (LOC125501099), mRNA.
ACCESSION   XM_048656001
VERSION     XM_048656001.1
DBLINK      BioProject: PRJNA846876
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Athalia rosae (coleseed sawfly)
  ORGANISM  Athalia rosae
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Tenthredinoidea;
            Athaliidae; Athalia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_064030) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Athalia rosae Annotation Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Athalia rosae"
                     /mol_type="mRNA"
                     /db_xref="taxon:37344"
                     /chromosome="5"
     gene            1..618
                     /gene="LOC125501099"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:125501099"
     CDS             1..618
                     /gene="LOC125501099"
                     /codon_start=1
                     /product="involucrin-like"
                     /protein_id="XP_048511958.1"
                     /db_xref="GeneID:125501099"
                     /translation="
MEFTRHPSVIQDELNQVDRLKHEFKQLDCLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDLLKHKFNQLDCLRDKLNQVDRLKNNFNQLDRLKHELNQLDGLKDKLNQVDRLKHEFKQLDCLKDELNQLDRLKHNCN"
     misc_feature    52..>591
                     /gene="LOC125501099"
                     /note="Chromosome segregation ATPase [Cell cycle control,
                     cell division, chromosome partitioning]; Region: Smc;
                     COG1196"
                     /db_xref="CDD:224117"
ORIGIN      
atggagttcactagacacccgagcgtgatacaagatgaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatctcctcaaacacaaattcaaccaacttgattgcctgagagataaattgaatcaagttgatcgcctgaaaaacaatttcaaccaacttgatcgcctgaaacacgaactcaaccaacttgatggccttaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatctcctcaaacacaaattcaaccaacttgattgcctgagagataaattgaatcaagttgatcgcctgaaaaacaatttcaaccaacttgatcgcctgaaacacgaactcaaccaacttgatggccttaaagataaattgaatcaagttgatcgcctgaaacacgaattcaagcaacttgattgcctgaaagatgaattgaatcaacttgatcgcctgaaacacaattgcaactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]