2024-05-20 20:36:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_024492116 285 bp mRNA linear INV 04-APR-2018 DEFINITION Echinococcus granulosus hypothetical protein (EGR_02867), partial mRNA. ACCESSION XM_024492116 VERSION XM_024492116.1 DBLINK BioProject: PRJNA182977 BioSample: SAMN01914755 KEYWORDS RefSeq. SOURCE Echinococcus granulosus ORGANISM Echinococcus granulosus Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Platyhelminthes; Cestoda; Eucestoda; Cyclophyllidea; Taeniidae; Echinococcus; Echinococcus granulosus group. REFERENCE 1 (bases 1 to 285) AUTHORS Zheng,H., Zhang,W., Zhang,L., Zhang,Z., Li,J., Lu,G., Zhu,Y., Wang,Y., Huang,Y., Liu,J., Kang,H., Chen,J., Wang,L., Chen,A., Yu,S., Gao,Z., Jin,L., Gu,W., Wang,Z., Zhao,L., Shi,B., Wen,H., Lin,R., Jones,M.K., Brejova,B., Vinar,T., Zhao,G., McManus,D.P., Chen,Z., Zhou,Y. and Wang,S. TITLE The genome of the hydatid tapeworm Echinococcus granulosus JOURNAL Nat. Genet. 45 (10), 1168-1175 (2013) PUBMED 24013640 REFERENCE 2 (bases 1 to 285) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-APR-2018) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 285) AUTHORS Zheng,H., Zhang,W., Zhang,L., Zhu,Y., Huang,Y., McManus,D.P., Chen,Z., Zhou,Y. and Wang,S. TITLE Direct Submission JOURNAL Submitted (27-FEB-2013) Shanghai-MOST Key Laboratory of Health and Disease Genomics, Chinese National Human Genome Center at Shanghai, No. 250 Bibo Road, Shanghai 201203, China COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_020170393). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..285 /organism="Echinococcus granulosus" /mol_type="mRNA" /db_xref="taxon:6210" /chromosome="Unknown" gene <1..>285 /locus_tag="EGR_02867" /db_xref="GeneID:36338582" CDS 1..285 /locus_tag="EGR_02867" /codon_start=1 /product="hypothetical protein" /protein_id="XP_024353610.1" /db_xref="GeneID:36338582" /translation="
MSIYVEQMRSKYTYLRIRMQRSNSVCRSTTSKTKWYLSFCHWMAVVYGRVSRRDWLDSKHQINQELEDALASLAKPQSPSGQMRAISLKNLPSL"
ORIGIN
atgtcaatttatgtggagcaaatgaggtcaaaatacacgtatttacgaatacgtatgcaacgttctaattcggtttgtcgcagtacgacttcaaaaaccaagtggtatttgtccttttgtcactggatggcagttgtttatggcagagtgtcaagaagagattggttggattctaagcaccaaataaatcaagaacttgaggatgcattagcatcactagccaaaccacaatctccctcaggacaaatgagggcaataagcttgaagaatttaccttctctgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]