GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 18:59:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_013407183             288 bp    mRNA    linear   PLN 05-JAN-2024
DEFINITION  Exophiala aquamarina CBS 119918 uncharacterized protein
            (A1O9_04897), partial mRNA.
ACCESSION   XM_013407183
VERSION     XM_013407183.1
DBLINK      BioProject: PRJNA292601
            BioSample: SAMN00974103
KEYWORDS    RefSeq.
SOURCE      Exophiala aquamarina CBS 119918
  ORGANISM  Exophiala aquamarina CBS 119918
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Chaetothyriomycetidae; Chaetothyriales;
            Herpotrichiellaceae; Exophiala.
REFERENCE   1  (bases 1 to 288)
  AUTHORS   Cuomo,C., de Hoog,S., Gorbushina,A., Walker,B., Young,S.K.,
            Zeng,Q., Gargeya,S., Fitzgerald,M., Haas,B., Abouelleil,A.,
            Allen,A.W., Alvarado,L., Arachchi,H.M., Berlin,A.M., Chapman,S.B.,
            Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M.,
            Howarth,C., Imamovic,A., Ireland,A., Larimer,J., McCowan,C.,
            Murphy,C., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S.,
            Shea,T., Sisk,P., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genomics Platform
  TITLE     The Genome Sequence of Exophiala aquamarina CBS 119918
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 288)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-DEC-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 288)
  AUTHORS   Cuomo,C., de Hoog,S., Gorbushina,A., Walker,B., Young,S.K.,
            Zeng,Q., Gargeya,S., Fitzgerald,M., Haas,B., Abouelleil,A.,
            Allen,A.W., Alvarado,L., Arachchi,H.M., Berlin,A.M., Chapman,S.B.,
            Gainer-Dewar,J., Goldberg,J., Griggs,A., Gujja,S., Hansen,M.,
            Howarth,C., Imamovic,A., Ireland,A., Larimer,J., McCowan,C.,
            Murphy,C., Pearson,M., Poon,T.W., Priest,M., Roberts,A., Saif,S.,
            Shea,T., Sisk,P., Sykes,S., Wortman,J., Nusbaum,C. and Birren,B.
  CONSRTM   The Broad Institute Genomics Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAR-2013) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_013550585).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..288
                     /organism="Exophiala aquamarina CBS 119918"
                     /mol_type="mRNA"
                     /strain="CBS 119918"
                     /culture_collection="CBS:119918"
                     /type_material="culture from type material of Exophiala
                     aquamarina"
                     /db_xref="taxon:1182545"
                     /chromosome="Unknown"
     gene            <1..>288
                     /locus_tag="A1O9_04897"
                     /db_xref="GeneID:25279824"
     CDS             1..288
                     /locus_tag="A1O9_04897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_013262637.1"
                     /db_xref="GeneID:25279824"
                     /translation="
MPDNPQFLGPLLPQHIAETINVSIGPSGENREYLLHLQDALEALSAHSHDEHIADLARRVRALDPPTRPACPSSIGHDLRKINSTEEQEEIEKDT"
     misc_feature    <4..189
                     /locus_tag="A1O9_04897"
                     /note="GGCT-like domains, also called AIG2-like family.
                     Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
                     formation of pyroglutamic acid (5-oxoproline) from
                     dipeptides containing gamma-glutamyl, and is a dimeric
                     protein. In Homo sapiens, the protein is...; Region:
                     GGCT_like; cl22886"
                     /db_xref="CDD:451440"
ORIGIN      
atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]