2024-05-20 13:26:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009681571 709 bp mRNA linear VRT 15-OCT-2014 DEFINITION PREDICTED: Struthio camelus australis VCP-interacting membrane protein (VIMP), mRNA. ACCESSION XM_009681571 VERSION XM_009681571.1 DBLINK BioProject: PRJNA263340 KEYWORDS RefSeq; includes ab initio. SOURCE Struthio camelus australis ORGANISM Struthio camelus australis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Palaeognathae; Struthioniformes; Struthionidae; Struthio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_009271683.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Struthio camelus australis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..709 /organism="Struthio camelus australis" /mol_type="mRNA" /isolate="BGI_N308" /sub_species="australis" /db_xref="taxon:441894" /chromosome="Unknown" /sex="female" /country="USA" gene 1..709 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:104148377" CDS 1..501 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_009679866.1" /db_xref="GeneID:104148377" /translation="
MTRLGSLLSSYGWYILLACVAIYLLIQKVSQSMAVRRSSQPAAADAAVEPDVVVKRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQELESGASTSSTVSKPKPNKKPLRSGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature 13..498 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:429198" ORIGIN
atgacaaggctgggttccctgctctccagctacggctggtacatcctcttggcctgtgtcgccatctatctcctcatccagaaggtatcccaaagcatggcagtccggcggagcagccagccagcagcagctgatgcagctgtcgaaccagacgtggtggtaaaaaggcaggaagctttggcagcagctcgcctcaggatgcaagaagagttgaatgcacaagcagaaagatacaaagaaaagcagagacagcttgaagaagagaaacgaaggcagaagatagcaatgtgggaaagtatgcaagagggaaaaagctacaaaggaaacctgaaactgaaccagcaagaattagaatctggtgcctccacctcttcgacagtctcaaaacctaaaccaaacaaaaagcctttgcggagtggtggctataaccctctgtccggagaaggaggtggaacttgttcctggagaccaggtcgcagaggcccatcagcaggtggatgaggctaacctccctagtgtctaatatcactagcaggcttaatcttacccactgtctaactgcctacagtttgcatgtcacagtgactcctttgggatttggtttagtgcgggtgttggcttgaaaacagatgtacatgagttccaggtattaacacagcaactgatactgcacaagaaaaatactcgatcccctttaaaaagctggtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]