2024-05-20 14:46:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_009580324 453 bp mRNA linear VRT 14-OCT-2014 DEFINITION PREDICTED: Fulmarus glacialis VCP-interacting membrane protein (VIMP), partial mRNA. ACCESSION XM_009580324 VERSION XM_009580324.1 DBLINK BioProject: PRJNA261828 KEYWORDS RefSeq; includes ab initio. SOURCE Fulmarus glacialis (Northern fulmar) ORGANISM Fulmarus glacialis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Procellariiformes; Procellariidae; Fulmarus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_009219316.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Fulmarus glacialis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 22% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..453 /organism="Fulmarus glacialis" /mol_type="mRNA" /isolate="BGI_N327" /db_xref="taxon:30455" /chromosome="Unknown" /sex="male" /country="Denmark" gene <1..453 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:104078621" CDS <1..453 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_009578619.1" /db_xref="GeneID:104078621" /translation="
CGIGCKSYMVMILPHLETRCRKAQTVLRICQNKPDMVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
misc_feature <100..450 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:429198" ORIGIN
tgtggcataggttgtaaatcttacatggtcatgatcctgcctcatttggagactcgctgccgtaaagcacagactgtacttagaatctgccaaaacaaacctgacatggtggtaagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggagttgaatgcacaagcagaaagatacaaagaaaaacaaagacagcttgaagaagagaagcgaagacagaagatagcaatgtgggaaagtatgcaagaaggaaaaagttataaaggaaacctgaaactgaatcagcaagaagtagaatctggtgcctccacctcatcagcagtcccgaaatctaaaccaaacaaaaaacccttgcgaggaggtggctataaccccctgtctggagaaggaggcggaacttgctcctggagaccaggccggagaggcccgtcagcaggtggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]