GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 15:34:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_009509775             330 bp    mRNA    linear   VRT 08-OCT-2014
DEFINITION  PREDICTED: Phalacrocorax carbo VCP-interacting membrane protein
            (VIMP), partial mRNA.
ACCESSION   XM_009509775
VERSION     XM_009509775.1
DBLINK      BioProject: PRJNA261839
KEYWORDS    RefSeq.
SOURCE      Phalacrocorax carbo (great cormorant)
  ORGANISM  Phalacrocorax carbo
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Suliformes; Phalacrocoracidae;
            Phalacrocorax.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_009125618.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Phalacrocorax carbo Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..330
                     /organism="Phalacrocorax carbo"
                     /mol_type="mRNA"
                     /isolate="BGI_N336"
                     /db_xref="taxon:9209"
                     /chromosome="Unknown"
                     /sex="male"
                     /country="Denmark"
     gene            <1..330
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:104049144"
     CDS             <1..330
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_009508070.1"
                     /db_xref="GeneID:104049144"
                     /translation="
EALAAARLRMQEELNAQAERYKEKQRQLEEEKRRQKIAMWESMQEGKSYKGNLKLNQQEAESGASTSSAVPKSKPNKKPLRGGGYNPLSGEGGGTCSWRPGRRGPSAGG"
     misc_feature    <1..327
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:429198"
ORIGIN      
gaagctttggcagcagctcgcctcaggatgcaagaggagttgaatgcacaagcagaaagatacaaagaaaaacaaagacagctggaagaagagaagcgaaggcagaagatagcgatgtgggaaagcatgcaagaaggaaaaagctataaaggaaacctgaaactgaatcagcaagaagcagaatctggtgcctccacctcatcagcagtcccgaagtctaaaccaaacaaaaagcccttgcgaggaggtggctataaccccctgtctggagaaggaggcggaacttgttcctggagaccaggccggagaggcccgtcagcaggcggatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]