2024-05-20 15:34:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006771772 785 bp mRNA linear MAM 09-FEB-2016 DEFINITION PREDICTED: Myotis davidii VCP interacting membrane selenoprotein (VIMP), mRNA. ACCESSION XM_006771772 VERSION XM_006771772.2 DBLINK BioProject: PRJNA232515 KEYWORDS RefSeq. SOURCE Myotis davidii ORGANISM Myotis davidii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Vespertilionidae; Myotis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006296417.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Feb 9, 2016 this sequence version replaced XM_006771772.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Myotis davidii Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..785 /organism="Myotis davidii" /mol_type="mRNA" /db_xref="taxon:225400" /chromosome="Unknown" /sex="male" /tissue_type="spleen, kidney and small intestine" /country="China: Taiyi Cave, Xianning, Wuhan, Hubei Province" /collection_date="21-Aug-2011" gene 1..785 /gene="VIMP" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 43 samples with support for all annotated introns" /db_xref="GeneID:102768176" CDS 93..395 /gene="VIMP" /codon_start=1 /product="selenoprotein S" /protein_id="XP_006771835.2" /db_xref="GeneID:102768176" /translation="
MQEELNAQVERHKEKLRQLEEEKRRRKIEMWDSLQEGKSYRGHARKPQEEDNPSPSTSSSLPKRPADRKPLRGGGYNPLSGEGGGACTWRPGRRGPSAGG"
misc_feature <93..392 /gene="VIMP" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:429198" ORIGIN
ccaggcagaggcggccggacccggcggcggctgctgtagctcccgaggacgttgtgagacggcaggaggctttggcggccgcgcgcctgaaaatgcaggaggaactaaacgcccaagtagaaaggcacaaggagaaactccggcagcttgaggaagagaaacggagaaggaagattgaaatgtgggacagcctgcaagaggggaaaagctacagaggtcatgccaggaagcctcaggaagaagacaaccccagcccttctacttcgtccagcctccccaagcggccagcagacaggaagcccctacgtgggggtggttataaccctttgtctggggaaggaggaggagcctgcacgtggcgacctggacgccgaggcccatcagctggcggatgaggctaagaaagccttgcccgtgtcactcgacacgaagcaagcccagccctcaccccaatccccttcaattgccttacgcaccctttctcacagtgaccaaggggctcactcctgtcctccacctgcacagcacccaccaggcaacagcgggtccccacctccgaaggaggcacctgacccaatcaagaacactgggacctagaggaacagccccctctcacagcccttggctgctgctaggacagtctctgtgataggttgcgtcgaatgacgtcctccttgtaaatggtgaagccaccaccaaggattaccgaggctcacagttgacggggtttctgtagatctgcacagaacactttgccaggtataaacgtttttaaagctgctgtc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]