2024-05-20 13:52:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_204990 892 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. ACCESSION NM_204990 VERSION NM_204990.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 892) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 892) AUTHORS Peale FV Jr, Sugden L and Bothwell M. TITLE Characterization of CMIX, a chicken homeobox gene related to the Xenopus gene mix.1 JOURNAL Mech Dev 75 (1-2), 167-170 (1998) PUBMED 9739137 REFERENCE 3 (bases 1 to 892) AUTHORS Stein S, Roeser T and Kessel M. TITLE CMIX, a paired-type homeobox gene expressed before and during formation of the avian primitive streak JOURNAL Mech Dev 75 (1-2), 163-165 (1998) PUBMED 9739135 REFERENCE 4 (bases 1 to 892) AUTHORS Peale FV Jr, Mason K, Hunter AW and Bothwell M. TITLE Multiplex display polymerase chain reaction amplifies and resolves related sequences sharing a single moderately conserved domain JOURNAL Anal Biochem 256 (2), 158-168 (1998) PUBMED 9473273 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAENSK010000062.1. On Sep 23, 2021 this sequence version replaced NM_204990.1. ##Evidence-Data-START## Transcript exon combination :: U34615.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992415 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-322 JAENSK010000062.1 4873588-4873909 c 323-892 JAENSK010000062.1 4872944-4873513 c FEATURES Location/Qualifiers source 1..892 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="3" /map="3" gene 1..892 /gene="MIXL1" /gene_synonym="CMIX" /note="Mix paired-like homeobox" /db_xref="CGNC:66215" /db_xref="GeneID:395838" exon 1..322 /gene="MIXL1" /gene_synonym="CMIX" /inference="alignment:Splign:2.1.0" CDS 14..646 /gene="MIXL1" /gene_synonym="CMIX" /note="homeodomain protein MIX; mix.1 homeobox-like protein; MIX1 homeobox-like protein 1; CMIX homeobox; Mix1 homeobox-like 1" /codon_start=1 /product="homeobox protein MIXL1" /protein_id="NP_990321.2" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="
MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLAALPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAPPPPPPQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL"
misc_feature 14..202 /gene="MIXL1" /gene_synonym="CMIX" /note="propagated from UniProtKB/Swiss-Prot (O73592.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(188..202,206..208,257..259,275..277,314..316, 320..325,332..337,341..349,353..358) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 194..355 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(194..196,203..205,323..325,332..337,344..346) /gene="MIXL1" /gene_synonym="CMIX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 326..595 /gene="MIXL1" /gene_synonym="CMIX" /note="propagated from UniProtKB/Swiss-Prot (O73592.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 323..892 /gene="MIXL1" /gene_synonym="CMIX" /inference="alignment:Splign:2.1.0" ORIGIN
ctggcccgccgccatggccgcgctacgcttcgggccgcccccggcggagctgcccgcggtaccgccctcctgcccgccgggccggtggctgtgcgggacggccgggggcagcgggggagggcccggcgcggccccggcgcccctcgcggcgctgcccccggcggcggagggggctccgtcggcgcaacgtcggaaacggacgagcttcacggcggcgcagctggagacgctggagctggtgttccaggacaccatgtaccccgacatctacctgcgggagcggctggccgacgccacgcagatccccgagtcccgcatccaggtctggttccagaaccgccgcgccaagtctcgccggcagcggggaccgccccggccgggtgcccccgcaccgccaccgcccccgccccagcgctcgccgtgcggcgcggccccgctgctccgcgcccgggaggagcaccgcgagtggccgccccgcgccgccggcccgcccggctccgcgctgcgcccgcacggggggagcggaggcgccccggccgggccctacccgccccgccccgcgttccccctcccggccggcggcggcttctcggagctgggaacggagtgggaggagaacgccatcggcgccttccgagccctctgacggccggccggccctgcccgcgcctctttgcactttatcccgtggactgcgcctatttatgcacgggagatgggggcggctgcgccggttgccggcaccgtgttacactgtttacagcttctatttaacctttttaagcccccaagccgaccgaatgcactgttctagggggggtgggggtcgggaggggtccgttgttactttttgagacagaaaaataaataaaagttcccaattctgctctgc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]