LOCUS       XM_445025                561 bp    mRNA    linear   PLN 15-JUL-2025
DEFINITION  Nakaseomyces glabratus homeobox domain-containing protein (homeobox
            domain-containing protein), partial mRNA.
ACCESSION   XM_445025
VERSION     XM_445025.1
DBLINK      BioProject: PRJNA1120907
            BioSample: SAMN13613350
KEYWORDS    RefSeq.
SOURCE      Nakaseomyces glabratus (Candida glabrata)
  ORGANISM  Nakaseomyces glabratus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces.
REFERENCE   1  (bases 1 to 561)
  AUTHORS   Xu,Z., Green,B., Benoit,N., Schatz,M., Wheelan,S. and Cormack,B.
  TITLE     De novo genome assembly of Candida glabrata reveals cell wall
            protein complement and structure of dispersed tandem repeat arrays
  JOURNAL   Mol. Microbiol. 113 (6), 1209-1224 (2020)
   PUBMED   32068314
REFERENCE   2  (bases 1 to 561)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUL-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 561)
  AUTHORS   Xu,Z., Green,B., Benoit,N., Schatz,M., Wheelan,S. and Cormack,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JAN-2020) Molecular Biology and Genetics, Johns
            Hopkins Medical Institution, 725 N Wolfe St, Baltimore, MD 21205,
            USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_088952).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..561
                     /organism="Nakaseomyces glabratus"
                     /mol_type="mRNA"
                     /strain="ATCC 2001"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:2001"
                     /type_material="type material of Cryptococcus glabratus"
                     /db_xref="taxon:5478"
                     /chromosome="B"
                     /collection_date="1917"
                     /collected_by="Anderson"
     gene            <1..>561
                     /gene="MATalpha2"
                     /locus_tag="GVI51_B01111"
                     /note="CAGL0B01265g;
                     Mating-type regulatory protein alpha2; expressed in all
                     MTLalpha strains and not in MTLa strains"
                     /db_xref="GeneID:2886680"
     CDS             1..561
                     /gene="MATalpha2"
                     /locus_tag="GVI51_B01111"
                     /note="CAGL0B01265g;
                     Mating-type regulatory protein alpha2; expressed in all
                     MTLalpha strains and not in MTLa strains"
                     /codon_start=1
                     /product="homeobox domain-containing protein"
                     /protein_id="XP_445025.1"
                     /db_xref="GeneID:2886680"
                     /translation="

MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNNLDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISPFRPTLMAQNSLDT"

     misc_feature    order(331..339,343..345,403..405,421..423,460..462,
                     466..471,478..483,487..495,499..501)
                     /gene="MATalpha2"
                     /locus_tag="GVI51_B01111"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(331..333,340..342,469..471,478..483,490..492)
                     /gene="MATalpha2"
                     /locus_tag="GVI51_B01111"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    340..501
                     /gene="MATalpha2"
                     /locus_tag="GVI51_B01111"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
ORIGIN      

atgtcaaagaaatcaagaattagtattacgcatctacttaatccaatacaagaagaaaatttaaaggaaaaattgcaagagattaataaccaacttatatcattgtgttccagtttacccaaaagacagtcgctcccggggccgtcgtccgatatcctaaggttcctatcgagaaacaacttggacccacaagagatagggttgatcaagacaacctatcgactgtctactcttctgtcaaaactacgggagcatgagatcgtattcaatgtggttaccaaagaccatctgcttaaaaaaggcgtccccaatcactatgccgcttcctatcgaggccaccgcttcacaagggaaaacgtacagatactagagacctggtaccgcaaccatatcgacaacccatacctcgaccacaacagccagcaatatctagcacagaagacaaacctctcaaaaatacagatcaaaaactgggtagcaaacagaagaagaaaacaaaagtcaatttacatctcaccattcagacctaccttgatggctcaaaacagcctcgacacttga

//