GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-01-18 20:55:56, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_076189009             634 bp    mRNA    linear   INV 12-AUG-2025
DEFINITION  PREDICTED: Oratosquilla oratoria metallo-beta-lactamase
            domain-containing protein 1-like (LOC143027628), transcript variant
            X7, mRNA.
ACCESSION   XM_076189009
VERSION     XM_076189009.1
DBLINK      BioProject: PRJNA1302514
KEYWORDS    RefSeq.
SOURCE      Oratosquilla oratoria
  ORGANISM  Oratosquilla oratoria
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
            Multicrustacea; Malacostraca; Eumalacostraca; Hoplocarida;
            Stomatopoda; Squillidae; Oratosquilla.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_134784) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_046742065.1-RS_2025_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/08/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..634
                     /organism="Oratosquilla oratoria"
                     /mol_type="mRNA"
                     /isolate="Oo_2021"
                     /isolation_source="ocean"
                     /db_xref="taxon:337810"
                     /chromosome="8"
                     /tissue_type="muscle"
                     /geo_loc_name="China"
                     /collection_date="2021-01"
     gene            1..634
                     /gene="LOC143027628"
                     /note="metallo-beta-lactamase domain-containing protein
                     1-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:143027628"
     CDS             89..619
                     /gene="LOC143027628"
                     /codon_start=1
                     /product="metallo-beta-lactamase domain-containing protein
                     1-like isoform X5"
                     /protein_id="XP_076045124.1"
                     /db_xref="GeneID:143027628"
                     /translation="
MLLVCVASHGLNCDDIGYAIATHGHSDHLGNLNLFLKAKHIVGFTISYQHEFFIHPFETGEPYKIDENVEVLPTPGHTTADVSVVVRTQDMGTVVVAGEKRPNGSNIEAKEDKTCLLVKASLASELEPFEEDSNSEEVISSENDCVAPEPTSLRPSRKTAPSSRDQVRSLALKRLL"
ORIGIN      
tatcttggtattagaaggataaaaacatccaggagtcgtatcagctgagaaactacagccctgaagttcggttttattgtgactgctgatgctacttgtgtgtgtggcatcacatggcttgaactgtgatgacattggatatgccatagcaacccatggccactcagaccacctagggaatctcaatctcttcttgaaggcaaagcacattgtaggattcaccatatcttaccagcatgagttcttcattcatccctttgaaacaggtgaaccatacaagatagacgagaatgtggaagtgctcccaacaccaggtcacaccacagctgatgtaagtgtggttgttcgaacccaggacatgggtactgtggttgtagctggagaaaaaagacctaacggatcaaatatagaagccaaagaagacaaaacttgccttttggttaaggcatctctggctagcgagttggagccctttgaagaggactcaaactcggaggaggttatttcttcggaaaacgactgtgtcgctccagaacctacctctttgagaccttctcgtaagactgcgccatcctctagggaccaagtaagatctctagctcttaaaaggttattgtaaattttcctcgaaagt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]