GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-19 20:19:31, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       XM_066652257            1808 bp    mRNA    linear   VRT 22-JUL-2024
DEFINITION  PREDICTED: Hoplias malabaricus claudin-1-like (LOC136675614), mRNA.
ACCESSION   XM_066652257
VERSION     XM_066652257.1
DBLINK      BioProject: PRJNA1136869
KEYWORDS    RefSeq.
SOURCE      Hoplias malabaricus (trahira)
  ORGANISM  Hoplias malabaricus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Characiformes; Characoidei; Erythrinidae; Hoplias.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_089818) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_029633855.1-RS_2024_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/19/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1808
                     /organism="Hoplias malabaricus"
                     /mol_type="mRNA"
                     /isolate="fHopMal1"
                     /db_xref="taxon:27720"
                     /chromosome="X1"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /geo_loc_name="Brazil: Represa do Rio Monjolinho - Sao
                     Carlos, State of Sao Paulo"
                     /lat_lon="21.985889 S 47.880722 W"
                     /collection_date="2021-04-21"
                     /collected_by="Marcelo de Bello Cioffi"
     gene            1..1808
                     /gene="LOC136675614"
                     /note="claudin-1-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 83 Proteins"
                     /db_xref="GeneID:136675614"
     CDS             61..1293
                     /gene="LOC136675614"
                     /codon_start=1
                     /product="claudin-1-like"
                     /protein_id="XP_066508354.1"
                     /db_xref="GeneID:136675614"
                     /translation="
MASAGMQMLGTAMAIIGWILAIVVCALPMWKVTAFVGSNIVTAQITWEGIWMSCVVQSTGQMQCKVYDSMLALSSDLQAARALCVICLLVGIVGIMLSLAGGKCTNCIRDPHSKAWACISAGILFIIAGLMCLIPVSWAANTIISDFYNPLIVESQRRELGTMGRIAKEVSGQTICFIGFIGVCLTCGLPLWRVTYYIGANIVTGQIVWDGLWMNCVMQSTGQMQCKIQSSILVLTQDLQAARALIVIAIVVCFAGVLLTFIGGRCSSCLKNESAMAKLVICGGILCIIAAIICLIPVSWSAAYTITDYFNPLTPATDKREIGGCIYIGWGTSFLLLLGGIILCTSCPPRDDIYNNPRMYPYQVPVVGPSGVYMPVKTYAPSVAYTGSGTYIPNKPYAAPAYSAVSGYRQ"
     misc_feature    73..528
                     /gene="LOC136675614"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    <673..1050
                     /gene="LOC136675614"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      
aacacgacatatttttttcggtctcatcatcttttggactaaggagtcagaagaggaagaatggcatcggctggaatgcaaatgctcggcacagccatggccatcattggctggatcttggctatcgtggtgtgcgctcttcccatgtggaaggtcacggctttcgtcgggtccaacatcgtgacggcgcagatcacctgggaggggatctggatgagctgtgtggtccagagcactgggcagatgcagtgtaaagtctacgactccatgctggccctcagctctgacctccaggcggccagggctttgtgtgtgatctgtcttctggttggcatcgtgggaatcatgctgtccttggctgggggcaagtgcaccaactgtatcagggatccgcacagcaaagcctgggcttgcatcagcgcagggattctgttcatcatcgctggcttgatgtgtctgatcccggtctcgtgggcagccaacaccatcatctccgacttttacaaccccttgatagtcgagtctcagcgtcgagagctggggacgatgggccggatagcgaaggaggtctcaggtcagaccatctgcttcatcggctttatcggtgtgtgcctgacatgtggattaccattgtggcgagtaacctactacattggtgccaacatcgtcactggtcagattgtgtgggatggattatggatgaactgcgtcatgcagagcacagggcagatgcagtgtaagatccagtcgtccatcttggtcttgacccaggacctgcaggctgcccgcgccctcattgtgatcgccatagtggtctgcttcgcgggtgtgctgctgaccttcatcggtggtcgttgcagcagctgcctcaaaaatgaatcagctatggccaaattggtcatctgcggtgggatcctctgtatcatagctgcgatcatctgcctgatccctgtcagctggtctgctgcctacaccatcactgactacttcaaccctctaacccccgccacagacaagagggagatcggtggctgcatatatattggctggggcacttcttttcttcttcttctcggagggatcatcttgtgcacttcttgtccaccaagggatgacatatacaacaacccaagaatgtacccctaccaagtgcctgtggttggaccctcaggggtgtatatgcctgtaaaaacatatgcgcccagtgttgcctacacaggatcaggcacttacatcccaaacaagccatatgcagctccggcatactcagctgtttcaggatatcgtcaataaaccacttgaataacatgcaactattgttttagacatctgtacaggagtcgagttcagcagttgttggtgtttatcaattgctggccgtgtaaattgtttgtagaccttaatgaactgtgatttatatcatgaatattacatttgattatgatgactgtacaatgtgtgaacgcctgtataatgtttgtaaatttatgcacagatgaaaagattttattaaatgatttatgttcataaaagtgttgtagtcttcagactaaaatcttacctatattttggtagttctttctttttctatatgatttaagaacagttttgtgcagaatgcaaatggatccctacaaaaaggaacaattgaaaaatgaataacgtgttgtttgttccttctcctgaaaatataaaaagcttgtatattgacttgtacaagaagttgtaactatgctggttcttctcattgaaaggaaagagtatgtacatgataggaaagttgtactctctctgagtgccaataaaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]