2024-11-19 21:40:52, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_066608595 1555 bp mRNA linear VRT 22-JUL-2024 DEFINITION PREDICTED: Eleutherodactylus coqui Meis homeobox 2 (MEIS2), transcript variant X7, mRNA. ACCESSION XM_066608595 VERSION XM_066608595.1 DBLINK BioProject: PRJNA1136876 KEYWORDS RefSeq. SOURCE Eleutherodactylus coqui (Puerto Rican coqui) ORGANISM Eleutherodactylus coqui Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Eleutherodactylidae; Eleutherodactylinae; Eleutherodactylus; Eleutherodactylus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_089842) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_035609145.1-RS_2024_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/19/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1555 /organism="Eleutherodactylus coqui" /mol_type="mRNA" /strain="aEleCoq1" /db_xref="taxon:57060" /chromosome="6" /sex="male" /tissue_type="whole body" /dev_stage="adult" /geo_loc_name="USA: Hawaii" /lat_lon="19.580062 N 154.923937 W" /collection_date="2018-07-06" /collected_by="Mara Laslo" gene 1..1555 /gene="MEIS2" /note="Meis homeobox 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:136633110" CDS 211..1380 /gene="MEIS2" /codon_start=1 /product="homeobox protein Meis2 isoform X7" /protein_id="XP_066464692.1" /db_xref="GeneID:136633110" /translation="
MSSKDPAHASMFLYDELPHYAMDGVGVPTSMYGDPHAPRPIPPVHHLNHGPPLHASQHYGTHAPHPNVMPTSMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDASSKSDHEELSGSSTNLADHNPASWRDHDDAVSTHSAGTPGPSSGGHASQSGDNSSEQGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM"
misc_feature 562..810 /gene="MEIS2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature 1078..1194 /gene="MEIS2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
ctctctctctcttcctctctctctctctgtttctctctttcagtagtcagtctcctctctcccactgccctgcttcctacttctctcaacatatttcctctttttccttatcgataatagtctttgatattttttcctccttctactattttctctcttagacattgcactttcttattcttatttttgggggggattttatatttttggatgagcagtaaagaccccgcacacgcctcaatgttcctgtacgatgagttaccgcactatgccatggatggagtgggggtgccaacttctatgtatggtgacccacatgcccctcgacctatcccaccggtacaccacttaaaccatggaccccctttacatgccagccagcattatggaactcatgcccctcatccaaatgttatgcccaccagcatgggatctgctgtgaacgatgccctcaaacgggataaagatgccatttatggacaccccctcttccctcttctagccctggtctttgagaagtgtgagttggcgacgtgtaccccccgggagcccggagtcgcaggaggggatgtttgttcctcggactcgtttaacgaagacatcgctgtatttgcaaaacaggttcgtgcagagaagccccttttctcctccaaccccgagctggacaatctgatgatccaggcgatccaggtcctgcggtttcatctcttggaattagaaaaggtccatgaattgtgtgataatttctgccatcgatacatcagctgtttgaaaggaaaaatgcccatagatttagtgattgatgagagggatgcaagctccaagtccgaccatgaagaactttctggatcctccacaaaccttgcagaccataatcctgcctcatggagagatcacgatgacgccgtatctacgcattcagcaggcacgccgggaccttccagtggtggacatgcgtcacaaagtggggacaacagcagtgagcaaggggacgatgatgacccagacaaggacaaaaagagacaaaagaaaagaggcatattccccaaagtagcaacgaatattatgagggcgtggcttttccagcatctcacgcatccatacccttcagaagaacagaagaaacagttagcacaagacacagggctgactatattgcaagtaaataactggttcattaatgccagaagacgaatagtccagccgatgattgaccagtctaatcgagcagtgagccaaggagcagcgtatagtccagaggggcagcctatgggaagctttgtattggacgggcagcaacatatgggcatccgacctgcaggacctatgagtggaatggggatgaatatgggcatggatgggcagtggcactatatgtaatcatcaaattgcagagcaatcacaaacaaggggaagtctgcagtacatgccaggggactgtctttctcagggtggtcctacgagtatcagtttggtacaaccagctcacacttctccccagttggcatcacacccttcctcaagacatggaccaccagtgccctacatctaccat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]