2024-11-19 20:32:15, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_057395547 381 bp mRNA linear PLN 13-JUN-2023 DEFINITION PREDICTED: Beta vulgaris subsp. vulgaris uncharacterized mitochondrial protein AtMg00310-like (LOC130591735), mRNA. ACCESSION XM_057395547 VERSION XM_057395547.1 DBLINK BioProject: PRJNA973951 KEYWORDS RefSeq; includes ab initio. SOURCE Beta vulgaris subsp. vulgaris ORGANISM Beta vulgaris subsp. vulgaris Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_079207) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_026745355.1-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/07/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..381 /organism="Beta vulgaris subsp. vulgaris" /mol_type="mRNA" /cultivar="EL10" /sub_species="vulgaris" /db_xref="taxon:3555" /chromosome="6" /tissue_type="leaf" /dev_stage="adult" /geo_loc_name="USA" gene 1..381 /gene="LOC130591735" /note="uncharacterized mitochondrial protein AtMg00310-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:130591735" CDS 1..381 /gene="LOC130591735" /codon_start=1 /product="uncharacterized mitochondrial protein AtMg00310-like" /protein_id="XP_057251530.1" /db_xref="GeneID:130591735" /translation="
MKEAARVEREIAIHPGKEVLIKLVAQAIPTYMMSVFSLPSGLIDEIHSLLARFWWGSSDTDRKMHWHSWDTLCYPKSMGGLGFRDLHCFNQSLLAKQAWRLCTGDQTLLYRLLQARYFKSSEFLEA"
ORIGIN
atgaaagaagctgcaagggtggaaagagaaattgctatccaccccgggaaagaggtgcttattaaattagtggcgcaagctattcccacgtatatgatgagtgtattcagccttcctagcggattgattgatgagattcattcgttgctggctcgattttggtgggggtcctctgacactgataggaagatgcattggcatagttgggatacgttgtgctaccccaaatcgatgggcggtcttggctttagggacctacactgcttcaaccaatctcttcttgcaaagcaagcatggcggttatgtacgggggaccagactcttctttatcggctgctgcaagcacgatactttaagtcttcggaatttctggaggcgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]