LOCUS       XM_046710201            1893 bp    mRNA    linear   INV 14-FEB-2022
DEFINITION  PREDICTED: Haliotis rubra biogenesis of lysosome-related organelles
            complex 1 subunit 3-like (LOC124274838), transcript variant X1,
            mRNA.
ACCESSION   XM_046710201
VERSION     XM_046710201.1
DBLINK      BioProject: PRJNA801670
KEYWORDS    RefSeq.
SOURCE      Haliotis rubra (blacklip abalone)
  ORGANISM  Haliotis rubra
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Gastropoda;
            Vetigastropoda; Lepetellida; Haliotoidea; Haliotidae; Haliotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025765947) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Haliotis rubra Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1893
                     /organism="Haliotis rubra"
                     /mol_type="mRNA"
                     /isolate="DU_JTF1"
                     /isolation_source="Aquaculture farm"
                     /db_xref="taxon:36100"
                     /chromosome="Unknown"
                     /tissue_type="muscle"
                     /dev_stage="adult"
                     /geo_loc_name="Australia: Jade Tiger Abalone Farm,
                     Indented Head, Victoria"
                     /collection_date="2017"
                     /collected_by="Adam Miller"
     gene            1..1893
                     /gene="LOC124274838"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 201 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:124274838"
     CDS             62..598
                     /gene="LOC124274838"
                     /codon_start=1
                     /product="biogenesis of lysosome-related organelles
                     complex 1 subunit 3-like isoform X1"
                     /protein_id="XP_046566157.1"
                     /db_xref="GeneID:124274838"
                     /translation="

MMEKGHYKTVVQGEASESDDEDMIPDDIPQGTVISGEASESEEEVDTSLQGDQELPALKVDRNRGENIQGSDPTQLPILTTTRMVTSKPKYDTLLHRKLRERNLQFHSHLVSLGSHAYMSAAKHINNTTQQLLKSHVAIQDVSHNMRLMTNDLFRLEDKINIISSCSLLPDINIELSS"

     misc_feature    86..580
                     /gene="LOC124274838"
                     /note="Biogenesis of lysosome-related organelles complex 1
                     subunit 3; Region: BLOC1S3; pfam15753"
                     /db_xref="CDD:464847"
     polyA_site      1893
                     /gene="LOC124274838"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

gaatcaaatgaagggacgcaactccatgtaagaggcggggcaccagaacagatatgagcacatgatggagaagggacattataaaacagtcgttcagggagaggcatctgagtctgatgatgaagacatgataccagatgacatccctcagggaacagtaatatctggggaggcatcagagtccgaggaggaggtggacaccagtctacagggagaccaagagttacctgccttgaaagttgacagaaaccgaggggagaacatccaagggagtgaccctacacagctgccgatcctcaccacaacccgcatggtgacaagcaaaccaaaatatgacacgctgctgcacagaaagctcagggagagaaatcttcagttccacagtcacctggtgagtctggggagccacgcctacatgtctgctgccaagcacatcaacaacaccacacagcagctgctcaagtcacatgttgctatccaggacgtgtctcacaacatgaggctgatgaccaacgacctgttccgcctggaggacaagatcaacattatctcctcctgtagcctgttacctgacatcaacatagaactgtcgtcatagcaacaccatctcctcctatgacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacaccatctcttcttgtaacctgttgcttgacatcaacgcagaactgtcatcatagcaacaccatctcctcctataacctgttgccaggcatcaagatagaactgttgtcatagcaacacaatctcttcttgtaacctgttgcttgacatcaacgcagaactgttgtcatagcaagaccatctcctcctgttacctgctacctgacatcaacatagaactgttgtcatagcaacaccatctcctcaagtaacccattaaatgacatcaatgcagaactgttgtcatagcaacacaatttcttcttgtaacctgttgcttgacatcaatgcagaactgttgtcatagcaacagatctcctcatgaaacctgctatctgacatcaacaaggactgctgtcatagcaacaccatctcctccagtaacccattgcctgacatcaacatagaactgttgtcatagcaacaccatctcttgtaaccttcctcactgacatcagctgttatcagtaaagccttaccattattctaccgagaggtcaactgatgttaaagagtcaatgaatcttccctttcttccatgcaagcaattgtgcaatatgtaggtagggtaaaactgaccttatttaaaacattcctttataaaacttatgattctgtgtaaaatcagatgtgactttcacaggagtcatcctccactgcagactgattgcctgcaaagccagctcatttcatgtcctgcagccaatactttggtttgaacagattgcctttgaaaattatgtatttatgaagttatttcatcacttgttggaaaacaacttgtccagggaaataacagaccagatctacactgatcatgaaacataatgatgtttgcatttattgagaaatgtcatatttttcattatcatatgaatgcatgatttgtaaatttaatggtataatattatttattttattgttaacaacaacaaaatgggtgttgatttgtttataaagctgttgtggattaagaactgttttattggttaaagaatgagcactgaatattgtctttgtgtaaatagatcaaacaatgttgatgtaccataattatgtcatataaaccactcaaaaaca

//