LOCUS       NM_126204               1018 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17),
            partial mRNA.
ACCESSION   NM_126204
VERSION     NM_126204.3
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1018)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 1018)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1018)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1018)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Sep 12, 2016 this sequence version replaced NM_126204.2.
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..1018
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            <1..1018
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5;
                     homeobox-leucine zipper protein 17"
                     /db_xref="Araport:AT2G01430"
                     /db_xref="GeneID:814671"
                     /db_xref="TAIR:AT2G01430"
     CDS             1..828
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5;
                     homeobox-leucine zipper protein 17"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1,
                     INSD:DR751539.1"
                     /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1"
                     /note="homeobox-leucine zipper protein 17 (HB17);
                     FUNCTIONS IN: sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent, regulation of transcription; LOCATED IN:
                     nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved
                     site (InterPro:IPR017970), Homeobox (InterPro:IPR001356),
                     Homeodomain-like (InterPro:IPR009057), Leucine zipper,
                     homeobox-associated (InterPro:IPR003106),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: homeobox-leucine zipper protein
                     18 (TAIR:AT1G70920.1); Has 8030 Blast hits to 8017
                     proteins in 519 species: Archae - 0; Bacteria - 0; Metazoa
                     - 5631; Fungi - 276; Plants - 1985; Viruses - 4; Other
                     Eukaryotes - 134 (source: NCBI BLink)."
                     /codon_start=1
                     /product="homeobox-leucine zipper protein 17"
                     /protein_id="NP_178252.2"
                     /db_xref="Araport:AT2G01430"
                     /db_xref="GeneID:814671"
                     /db_xref="TAIR:AT2G01430"
                     /translation="

MIKLLFTYICTYTYKLYALYHMDYACVCMYKYKGIVTLQVCLFYIKLRVFLSNFTFSSSILALKNPNNSLIKIMAILPENSSNLDLTISVPGFSSSPLSDEGSGGGRDQLRLDMNRLPSSEDGDDEEFSHDDGSAPPRKKLRLTREQSRLLEDSFRQNHTLNPKQKEVLAKHLMLRPRQIEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEENHRLHREVEELRAMKVGPTTVNSASSLTMCPRCERVTPAASPSRAVVPVPAKKTFPPQERDR"

     misc_feature    406..576
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5;
                     homeobox-leucine zipper protein 17"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(409..423,427..429,478..480,496..498,535..537,
                     541..546,553..558,562..570,574..579)
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5;
                     homeobox-leucine zipper protein 17"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(415..417,424..426,544..546,553..558,565..567)
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5;
                     homeobox-leucine zipper protein 17"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    580..711
                     /gene="HB17"
                     /locus_tag="AT2G01430"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE
                     ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5;
                     homeobox-leucine zipper protein 17"
                     /note="homeobox associated leucin zipper; Region: HALZ;
                     smart00340"
                     /db_xref="CDD:128634"
ORIGIN      

atgataaaactactatttacgtacatatgcacatacacatataaactatatgctctatatcatatggattacgcatgcgtgtgtatgtataaatataaaggcatcgtcacgcttcaagtttgtctcttttatattaaactgagagttttcctctcaaactttaccttttcttcttcgatcctagctcttaagaaccctaataattcattgatcaaaataatggcgattttgccggaaaactcttcaaacttggatcttactatctccgttccaggcttctcttcatcccctctctccgatgaaggaagtggcggaggaagagaccagctaaggctagacatgaatcggttaccgtcgtctgaagacggagacgatgaagaattcagtcacgatgatggctctgctcctccgcgaaagaaactccgtctaaccagagaacagtcacgtcttcttgaagatagtttcagacagaatcatacccttaatcccaaacaaaaggaagtacttgccaagcatttgatgctacggccaagacaaattgaagtttggtttcaaaaccgtagagcaaggagcaaattgaagcaaaccgagatggaatgcgagtatctcaaaaggtggtttggttcattaacggaagaaaaccacaggctccatagagaagtagaagagcttagagccatgaaggttggcccaacaacggtgaactctgcctcgagccttactatgtgtcctcgctgcgagcgagttacccctgccgcgagcccttcgagggcggtggtgccggttccggctaagaaaacgtttccgccgcaagagcgtgatcgttgatttgtgtatcttaattatttgagtatggtttagaagtcaacgaaggtctgctattgagcctacaaaatattaacgatcacatgatttcgtgtaaatactaagagactctgttccgctttgtaaatattattattattattgttaaccagaagtcccttatcatttaatcttgtttgaaataacataagat

//