GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-19 20:41:15, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_001252450            2187 bp    mRNA    linear   ROD 04-JUN-2024
DEFINITION  Mus musculus claudin domain containing 1 (Cldnd1), transcript
            variant 2, mRNA.
ACCESSION   NM_001252450
VERSION     NM_001252450.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2187)
  AUTHORS   Ohnishi,M., Ochiai,H., Matsuoka,K., Akagi,M., Nakayama,Y.,
            Shima,A., Uda,A., Matsuoka,H., Kamishikiryo,J., Michihara,A. and
            Inoue,A.
  TITLE     Claudin domain containing 1 contributing to endothelial cell
            adhesion decreases in presence of cerebellar hemorrhage
  JOURNAL   J Neurosci Res 95 (10), 2051-2058 (2017)
   PUBMED   28244141
  REMARK    GeneRIF: suggest that the transient decrease of CLDND1 after
            cerebellar hemorrhage is responsible for low-molecular-weight
            selective vascular hyperpermeability
REFERENCE   2  (bases 1 to 2187)
  AUTHORS   Mineta,K., Yamamoto,Y., Yamazaki,Y., Tanaka,H., Tada,Y., Saito,K.,
            Tamura,A., Igarashi,M., Endo,T., Takeuchi,K. and Tsukita,S.
  TITLE     Predicted expansion of the claudin multigene family
  JOURNAL   FEBS Lett 585 (4), 606-612 (2011)
   PUBMED   21276448
REFERENCE   3  (bases 1 to 2187)
  AUTHORS   Piao,Y., Ko,N.T., Lim,M.K. and Ko,M.S.
  TITLE     Construction of long-transcript enriched cDNA libraries from
            submicrogram amounts of total RNAs by a universal PCR amplification
            method
  JOURNAL   Genome Res 11 (9), 1553-1558 (2001)
   PUBMED   11544199
REFERENCE   4  (bases 1 to 2187)
  AUTHORS   Mohlke,K.L., Purkayastha,A.A., Westrick,R.J. and Ginsburg,D.
  TITLE     Comparative mapping of distal murine chromosome 11 and human
            17q21.3 in a region containing a modifying locus for murine plasma
            von Willebrand factor level
  JOURNAL   Genomics 54 (1), 19-30 (1998)
   PUBMED   9806826
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC159200.2.
            
            Transcript Variant: This variant (2) uses an alternate internal
            splice site and initiates translation at an upstream, in-frame
            start codon, compared to variant 1. The encoded isoform (2) has a
            longer and distinct N-terminus, compared to isoform 1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1660821.149219.1,
                                           SRR1660811.75950.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-175               AC159200.2         55504-55678         c
            176-219             AC159200.2         54365-54408         c
            220-529             AC159200.2         53841-54150         c
            530-640             AC159200.2         52176-52286         c
            641-778             AC159200.2         50870-51007         c
            779-2187            AC159200.2         49341-50749         c
FEATURES             Location/Qualifiers
     source          1..2187
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="16"
                     /map="16 34.83 cM"
     gene            1..2187
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /note="claudin domain containing 1"
                     /db_xref="GeneID:224250"
                     /db_xref="MGI:MGI:2447860"
     exon            1..175
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    121..123
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /note="upstream in-frame stop codon"
     CDS             169..999
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /note="isoform 2 is encoded by transcript variant 2;
                     claudin domain-containing protein 1; claudin 25"
                     /codon_start=1
                     /product="claudin domain-containing protein 1 isoform 2"
                     /protein_id="NP_001239379.1"
                     /db_xref="GeneID:224250"
                     /db_xref="MGI:MGI:2447860"
                     /translation="
MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA"
     misc_feature    286..939
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            176..219
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /inference="alignment:Splign:2.1.0"
     exon            220..529
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /inference="alignment:Splign:2.1.0"
     exon            530..640
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /inference="alignment:Splign:2.1.0"
     exon            641..778
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /inference="alignment:Splign:2.1.0"
     exon            779..2187
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2160..2165
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /note="hexamer: AATAAA"
     polyA_site      2180
                     /gene="Cldnd1"
                     /gene_synonym="1110019C08Rik; claudin-25; Cldn25"
                     /note="major polyA site"
ORIGIN      
aaggcccctcggcccagggccgctttggcccggcctggggtggaggtggaggcggaggcgcgggagttatggagggggcgggctctgcagggaagtacgtcagaggaggcgcggggagagtagggtgctgtggtcggagctggagggcgaagccggtggagtgagaggatgggcggtgatagactagagaacaagacttctgtctccgtagcatcttggagcagtctgaatgccagaatggataaccgttttgctactgcgtttgtgattgcttgtgtgcttagtctgatttccaccatctacatggcggcctccataggcacggacttctggtatgagtatcgaagtcccattcaagagaattcaagtgactcgaataaaatcgcctgggaagatttcctcggtgacgaggcggatgagaagacttacaacgatgttctgttccgatacaacggcagcttggggctgtggagacggtgcatcaccatacccaaaaacactcactggtatgcgccaccggaaaggacagagtcatttgatgtggttaccaaatgcatgagtttcacactaaacgagcagttcatggagaagtatgtggaccccggcaaccacaatagcggcatcgacctgcttcgcacctacctgtggcgctgccagttccttttacccttcgtcagcttgggcttgatgtgctttggggcgttgattggcctctgtgcctgtatctgccgcagcctgtatcccaccctcgccactggcattctccatctccttgcaggtctgtgcacactgggctccgtgagttgctatgttgccggcattgaactcttacatcagaaagtagagctgcccaaggatgtatctggagaatttggatggtccttctgcctggcctgcgtctcggctcccttacagttcatggcggccgctctcttcatctgggctgcccacaccaaccggaaagagtacaccttaatgaaggcttatcgtgtggcatgaagggaggctgcctgcttaatgattaatatttttcatacattttttttaactattgaggttttcccttgtcttcctctcagtcgtctttaatttttatttttgtggatatgccattgtattctaaaagccccttttatttatatacagtgccactaaataccatttaaaatgtgtgtggttttcactgagtgacttagtctttttttaccacactgatctaggttcagagttcagacagaaagaactgtagagatgtgacccaagtttgtaaaagaatattagcagtggcaaattgacccaaaacagggtctgctaacgtctgctcagtccagtagtgcagtaactatgaaactagaaatgaatttctgtatgatatctgttatcactgtcagacttcatctttactttcctgttgttgctagcagaaccagcgttcctcaagatgtgtgcacataaaattgggaaatgagctaacatgtgtccctaaactttggtacattactttatttgaggtgaaatatggcagctgtttatactgtgattgtctacaagaaaaaaaaaagtgaaaaatgatgtttacttgaaattgtgcttttaatttcacttcagtgaggaaagttgactaattgtactacactatacctgtttgttttttttttaaactgaaactcatcaggattttcagtgccaccaaaccattgtggatttttgctgctcccctcccccctcccccccacaccaggcttattaaagagtactttctttttaacagagtgagagaagagtcacagccaattcctcaacttctttgttctagctgagtactatatgggaggtcctaccaatatcgaccccccagaactgggggtactaccaccacaagatctaaagctgtagctgccacctactaacctccatttatgggtctttatttcttgtggtgaaatgatgtgcctttccttgcccaaatcccttcctggtgtgtatcaacattacttaatgtcttctaattcagtcatttttttataatatgtcttctgtaaacattgaacttaaaaatcttatttatttactccattattgtagcatttcacagattcaaaaaagtgtaactcagtaatttcttaccaaatcctaaatctgtcttttttaaaaaaataaataaaaaagagaatcatgtagagtgtc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]