2025-04-21 03:04:18, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001182701 303 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36A (RPL36A), partial mRNA. ACCESSION NM_001182701 VERSION NM_001182701.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 303) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 303) AUTHORS Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T., Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S., Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M., Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII JOURNAL Nature 387 (6632 SUPPL), 90-93 (1997) PUBMED 9169872 REFERENCE 3 (bases 1 to 303) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 303) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 303) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 303) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001145). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XIII" gene <1..>303 /gene="RPL36A" /locus_tag="YMR194W" /gene_synonym="RPL39B" /db_xref="GeneID:855232" CDS 1..303 /gene="RPL36A" /locus_tag="YMR194W" /gene_synonym="RPL39B" /experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic translation [PMID:18782943]" /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding [PMID:6337137]" /experiment="EXISTENCE:direct assay:GO:0003735 structural constituent of ribosome [PMID:18782943]" /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic large ribosomal subunit [PMID:18782943]" /note="Ribosomal 60S subunit protein L36A; N-terminally acetylated; binds to 5.8 S rRNA; homologous to mammalian ribosomal protein L36, no bacterial homolog; RPL36A has a paralog, RPL36B, that arose from the whole genome duplication" /codon_start=1 /product="ribosomal 60S subunit protein L36A" /protein_id="NP_013920.1" /db_xref="GeneID:855232" /db_xref="SGD:S000004807" /translation="
MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
misc_feature 10..297 /gene="RPL36A" /locus_tag="YMR194W" /gene_synonym="RPL39B" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]