GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-19 20:46:19, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_001166313             972 bp    mRNA    linear   MAM 20-FEB-2022
DEFINITION  Sus scrofa cyclin H (CCNH), mRNA.
ACCESSION   NM_001166313
VERSION     NM_001166313.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
REFERENCE   1  (bases 1 to 972)
  AUTHORS   Fujii W, Nishimura T, Kano K, Sugiura K and Naito K.
  TITLE     CDK7 and CCNH are components of CDK-activating kinase and are
            required for meiotic progression of pig oocytes
  JOURNAL   Biol. Reprod. 85 (6), 1124-1132 (2011)
   PUBMED   21778139
  REMARK    GeneRIF: CDK7 and CCNH activate CDC2 by T161 phosphorylation and
            make up CDK-activating kinase, which is required for normal meiotic
            progression during porcine oocyte maturation.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB499892.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB499892.1, SRR5275317.44162.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103886115 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..972
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="2"
                     /map="2"
     gene            1..972
                     /gene="CCNH"
                     /note="cyclin H"
                     /db_xref="GeneID:100310796"
                     /db_xref="VGNC:VGNC:86359"
     CDS             1..972
                     /gene="CCNH"
                     /codon_start=1
                     /product="cyclin-H"
                     /protein_id="NP_001159785.1"
                     /db_xref="GeneID:100310796"
                     /db_xref="VGNC:VGNC:86359"
                     /translation="
MYHNSSQKRHWTFASEEQLARLRADANRKFRCKAVANGKVLPNDPIFLEPHEEMILCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPMLENPEILRKTADDFLSRVALTDAHLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTSLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSPELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVDSL"
     misc_feature    4..924
                     /gene="CCNH"
                     /note="cyclin ccl1; Region: ccl1; TIGR00569"
                     /db_xref="CDD:129660"
     exon            1..117
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            118..240
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            241..314
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            315..525
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            526..689
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            690..760
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            761..872
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            873..933
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
     exon            934..972
                     /gene="CCNH"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgtaccacaatagtagccagaagcggcactggactttcgccagtgaggagcagctagcccggttgcgggccgacgccaaccgcaaattcagatgcaaagcagtggcgaatgggaaggttcttccaaatgacccaatctttcttgagcctcatgaagaaatgatactctgcaaatactatgagaaaagattattggaattctgttcagtgtttaagccagcaatgccaaggtctgttgtgggtacggcttgtatgtatttcaagcgtttttatcttaataactcagttatggaatatcacccccggataataatgctcacttgtgcatttttggcctgcaaggtagatgaattcaatgtatctagtccacaatttgttggaaatctgcgggagagtcctcttggacaagagaaagcacttgaacagattttggaatatgaactgctccttatacaacagcttaatttccaccttattgtccacaatccttatagaccttttgagggctttctcattgatttaaagactcgatatcccatgttggagaatccagagattttgaggaagacagctgatgactttctcagtagagttgcattgacggatgctcaccttttatacacaccttcccagattgccctgactgccattttatctagtgcatccagagcaggaattactatggaaagttatttatcagaaagtctgatgctcaaagagaacagaactagcctgtcacagttactagatattatgaaaagcatgagaaacttggtaaaaaaatatgaaccacccagatctgaagaagttgctgttctgaaacagaagttggagagatgtcactctcctgagcttgcacttaacgtaattaccaagaagaggaaaggttatgaagatgatgattatgtctcaaagaaatccaaacatgaggaggaagaatggactgatgatgacctggtagattccctgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]