2025-04-20 15:34:50, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001100629 975 bp mRNA linear VRT 03-APR-2024 DEFINITION Danio rerio taste receptor, type 2, member 202 (tas2r202), mRNA. ACCESSION NM_001100629 XM_001339344 VERSION NM_001100629.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 975) AUTHORS Kowatschew,D. and Korsching,S.I. TITLE An Ancient Adenosine Receptor Gains Olfactory Function in Bony Vertebrates JOURNAL Genome Biol Evol 13 (9) (2021) PUBMED 34499158 REFERENCE 2 (bases 1 to 975) AUTHORS Behrens,M., Di Pizio,A., Redel,U., Meyerhof,W. and Korsching,S.I. TITLE At the Root of T2R Gene Evolution: Recognition Profiles of Coelacanth and Zebrafish Bitter Receptors JOURNAL Genome Biol Evol 13 (1) (2021) PUBMED 33355666 REFERENCE 3 (bases 1 to 975) AUTHORS Wang,S., Ji,D., Yang,Q., Li,M., Ma,Z., Zhang,S. and Li,H. TITLE NEFLb impairs early nervous system development via regulation of neuron apoptosis in zebrafish JOURNAL J Cell Physiol 234 (7), 11208-11218 (2019) PUBMED 30569449 REFERENCE 4 (bases 1 to 975) AUTHORS Pasquier,J., Cabau,C., Nguyen,T., Jouanno,E., Severac,D., Braasch,I., Journot,L., Pontarotti,P., Klopp,C., Postlethwait,J.H., Guiguen,Y. and Bobe,J. TITLE Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database JOURNAL BMC Genomics 17, 368 (2016) PUBMED 27189481 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 975) AUTHORS Ohmoto,M., Okada,S., Nakamura,S., Abe,K. and Matsumoto,I. TITLE Mutually exclusive expression of Galphaia and Galpha14 reveals diversification of taste receptor cells in zebrafish JOURNAL J Comp Neurol 519 (8), 1616-1629 (2011) PUBMED 21452212 REFERENCE 6 (bases 1 to 975) AUTHORS Oike,H., Nagai,T., Furuyama,A., Okada,S., Aihara,Y., Ishimaru,Y., Marui,T., Matsumoto,I., Misaka,T. and Abe,K. TITLE Characterization of ligands for fish taste receptors JOURNAL J Neurosci 27 (21), 5584-5592 (2007) PUBMED 17522303 REFERENCE 7 (bases 1 to 975) AUTHORS Ishimaru,Y., Okada,S., Naito,H., Nagai,T., Yasuoka,A., Matsumoto,I. and Abe,K. TITLE Two families of candidate taste receptors in fishes JOURNAL Mech Dev 122 (12), 1310-1321 (2005) PUBMED 16274966 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AB290688.1. On Aug 8, 2007 this sequence version replaced XM_001339344.1. FEATURES Location/Qualifiers source 1..975 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="8" /map="8" gene 1..975 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="taste receptor, type 2, member 202" /db_xref="GeneID:798975" /db_xref="ZFIN:ZDB-GENE-070917-7" CDS 1..975 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="taste receptor, type 2, member 5; zfT2R5" /codon_start=1 /product="taste receptor, type 2, member 202" /protein_id="NP_001094099.1" /db_xref="GeneID:798975" /db_xref="ZFIN:ZDB-GENE-070917-7" /translation="
MLSTQDKLVAWLLIGVLAILTIFFNMYLLLVNYRSYRKKHKLNPADFIITAIAIASISQQVLTYSWQTMDVIDTVCQISLVEAILLVLVFSVKLIIFWSTAFLTFYYGTKLVVEPVHCYTRIQEAIVKHVHIVLTVIVVSGFANCVPLLSVLTYYNGTTELGDCGSIMPSDTPGLVYVFYYVVISDIIPGIVMFKCSISISYHLAKHLLDMKASSNGTHGPKLGTQMRVIKMTLSLVFVYSCFVVVDIYTQTTVVLMRQNTLALIMLFASIYTTVSAFVLIYGKKSYWKELIASYNLFLDEYPCLNKMKVEEVKHEPHEHSHGH"
misc_feature 34..720 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Region: 7tm_classA_rhodopsin-like; cd00637" /db_xref="CDD:410626" misc_feature 34..105 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="TM helix 1 [structural motif]; Region: TM helix 1" /db_xref="CDD:410626" misc_feature 226..339 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:410626" misc_feature 385..444 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:410626" misc_feature 520..597 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:410626" exon 1..975 /gene="tas2r202" /gene_synonym="drT2R1; tas2r5" /inference="alignment:Splign:2.1.0" ORIGIN
atgctgtcgactcaagacaaactggtggcctggctgctgatcggcgtactggcgatcctgaccatcttcttcaacatgtatctgcttctagtcaactatagaagctacagaaaaaagcacaagctgaacccggcagacttcattattacagcaatcgccattgccagcatctcccagcaggtcctgacgtactcctggcagaccatggatgtgatcgacaccgtttgccaaatcagtctggtggaggccatattgttagtcctcgttttcagtgtgaagctcatcatattctggagcacggcctttctgactttttactatggcacgaaattagttgttgagcccgttcattgttacacaagaatccaagaagccattgtgaaacacgtccacattgtgttgacggtgatagttgtgagtggctttgcgaattgcgttcccttattgagtgtgttgacgtattacaatggcaccaccgaattgggcgattgtgggtctataatgccaagcgatacgcctgggcttgtctacgtcttctattacgttgtaatttctgacatcattccgggaatcgttatgttcaaatgcagcatttctatatcgtatcacttggcgaagcatcttctggacatgaaggcgagcagcaatggcactcacgggcctaaactcggcactcagatgcgggtgatcaagatgacgctcagtttggtgttcgtttacagctgttttgttgttgtggacatttacacgcagaccacggtggtgttgatgcggcagaacacactggctttgattatgctgttcgccagtatttacaccacagtcagtgcgttcgtgctgatttatgggaagaaaagctactggaaggagttgatcgcctcttataacctctttttagacgagtatccttgtttgaataaaatgaaggtcgaggaggtcaaacatgagccgcatgaacacagtcacgggcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]