GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-16 03:11:06, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001093656            1043 bp    mRNA    linear   VRT 27-APR-2025
DEFINITION  Xenopus laevis selenoprotein S L homeolog (selenos.L), mRNA.
ACCESSION   NM_001093656
VERSION     NM_001093656.2
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 1043)
  AUTHORS   Gladyshev,V.N., Arner,E.S., Berry,M.J., Brigelius-Flohe,R.,
            Bruford,E.A., Burk,R.F., Carlson,B.A., Castellano,S., Chavatte,L.,
            Conrad,M., Copeland,P.R., Diamond,A.M., Driscoll,D.M., Ferreiro,A.,
            Flohe,L., Green,F.R., Guigo,R., Handy,D.E., Hatfield,D.L.,
            Hesketh,J., Hoffmann,P.R., Holmgren,A., Hondal,R.J., Howard,M.T.,
            Huang,K., Kim,H.Y., Kim,I.Y., Kohrle,J., Krol,A., Kryukov,G.V.,
            Lee,B.J., Lee,B.C., Lei,X.G., Liu,Q., Lescure,A., Lobanov,A.V.,
            Loscalzo,J., Maiorino,M., Mariotti,M., Sandeep Prabhu,K.,
            Rayman,M.P., Rozovsky,S., Salinas,G., Schmidt,E.E., Schomburg,L.,
            Schweizer,U., Simonovic,M., Sunde,R.A., Tsuji,P.A., Tweedie,S.,
            Ursini,F., Whanger,P.D. and Zhang,Y.
  TITLE     Selenoprotein Gene Nomenclature
  JOURNAL   J Biol Chem 291 (46), 24036-24040 (2016)
   PUBMED   27645994
REFERENCE   2  (bases 1 to 1043)
  AUTHORS   Bubenik,J.L., Miniard,A.C. and Driscoll,D.M.
  TITLE     Alternative transcripts and 3'UTR elements govern the incorporation
            of selenocysteine into selenoprotein S
  JOURNAL   PLoS One 8 (4), e62102 (2013)
   PUBMED   23614019
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1043)
  AUTHORS   Mariotti,M., Ridge,P.G., Zhang,Y., Lobanov,A.V., Pringle,T.H.,
            Guigo,R., Hatfield,D.L. and Gladyshev,V.N.
  TITLE     Composition and evolution of the vertebrate and mammalian
            selenoproteomes
  JOURNAL   PLoS One 7 (3), e33066 (2012)
   PUBMED   22479358
REFERENCE   4  (bases 1 to 1043)
  AUTHORS   Klein,S.L., Strausberg,R.L., Wagner,L., Pontius,J., Clifton,S.W.
            and Richardson,P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DT058072.1, BC078025.1 and
            BG038772.1.
            
            On Jan 23, 2017 this sequence version replaced NM_001093656.1.
            
            Summary: This gene encodes a transmembrane protein that is
            localized in the endoplasmic reticulum (ER). It is involved in the
            degradation process of misfolded proteins in the ER, and may also
            have a role in inflammation control. This protein is a
            selenoprotein, containing the rare amino acid selenocysteine (Sec).
            Sec is encoded by the UGA codon, which normally signals translation
            termination. The 3' UTRs of selenoprotein mRNAs contain a conserved
            stem-loop structure, designated the Sec insertion sequence (SECIS)
            element, that is necessary for the recognition of UGA as a Sec
            codon, rather than as a stop signal. Two additional stem-loop
            structures in the 3' UTR of this mRNA have been shown to function
            as modulators of Sec insertion. A homeolog of this gene is found on
            chromosome 3S. [provided by RefSeq, Jul 2017].
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC078025.1, CK797916.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16655500 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            protein contains selenocysteine :: inferred from conservation
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-52                DT058072.1         1-52
            53-837              BC078025.1         1-785
            838-1043            BG038772.1         1-206               c
FEATURES             Location/Qualifiers
     source          1..1043
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="3L"
                     /map="3L"
     gene            1..1043
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="selenoprotein S L homeolog"
                     /db_xref="GeneID:447014"
                     /db_xref="Xenbase:XB-GENE-6254582"
     exon            1..135
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /inference="alignment:Splign:2.1.0"
     CDS             57..638
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="UGA stop codon recoded as selenocysteine;
                     selenoprotein S A; selS A; VCP-interacting membrane
                     protein; VCP-interacting membrane selenoprotein L
                     homeolog"
                     /codon_start=1
                     /transl_except=(pos:630..632,aa:Sec)
                     /product="selenoprotein S L homeolog"
                     /protein_id="NP_001087125.2"
                     /db_xref="GeneID:447014"
                     /db_xref="Xenbase:XB-GENE-6254582"
                     /translation="
MELGNQPGPGNRPEIELEWYQYVQNTVGWALASYGWYILFGCIILYFLIQKLSANFTRAGASTHTTVTDPDEIVRRQEAVTAARMRMQEELNAQAELYKQKQVQLQEEKRRRNIETWDRMQEGKSSKVACRLGQDASPSTSASSSPSTSSSAPKPKPERKPLRGSGYNPLTGDGGSTCAWRPGRRGPSSGGUG"
     misc_feature    57..629
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
     misc_feature    141..203
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6AZH0.2);
                     transmembrane region"
     misc_feature    396..635
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6AZH0.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    630..632
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="Selenocysteine; other site"
     exon            136..261
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /inference="alignment:Splign:2.1.0"
     exon            262..368
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /inference="alignment:Splign:2.1.0"
     exon            369..458
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /inference="alignment:Splign:2.1.0"
     exon            459..552
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /inference="alignment:Splign:2.1.0"
     exon            553..1037
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /inference="alignment:Splign:2.1.0"
     regulatory      886..983
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
                     /note="SECIS_element"
                     /function="essential for recoding UGA to specify
                     selenocysteine"
     polyA_site      1037
                     /gene="selenos.L"
                     /gene_synonym="AD-015; ADO15; SBBI8; sels-a; seps1; vimp;
                     vimp-a; vimp.L"
ORIGIN      
tggtcggtccgagaataaacatagaaaccggatcttgtcttgtggggatcctcaacatggagctgggaaaccaaccggggccggggaatcgtcccgaaatagaactggagtggtaccagtatgttcagaacacagttggctgggctcttgcaagctatggctggtacattttatttggctgcatcattctatatttcttgattcagaagttgtctgcaaacttcacacgagctggcgcgtctactcacaccactgtgacagaccctgatgagattgtcagaagacaagaagcagtgacagccgcccggatgcgaatgcaggaggagttaaacgctcaggctgaattatacaaacagaagcaggttcagttgcaagaagaaaagcggcggcggaacatagagacctgggatcgtatgcaagaagggaagagttccaaggtggcctgccgtcttggccaggatgcatctcctagcacctccgcttcatcatccccctccacttcatcatctgccccaaagcccaagccagagaggaaaccattgcgtggcagtggatacaatcctctgacaggagatggaggcagtacatgtgcttggcgaccaggccgaaggggtccttcttcaggaggatgaggttaagcctcttgctggtatattaccccctgggaatatcagcaagatgaaaataatgcaccacctgcagtaatagtgtcgattccaaaggccctccgtccgtgattatttagaactagagcttggatataccatgtactgtctgtctgctcacactgtctctgatttttatgggggaagtcatcacttgatgactgtgaaggaactcttgggaagaagaagctggaattctgtcagatcagatcgggctggggaattttgtcactgcaatctggcactttacatgatgtcatccttacaaatggcacagtagccaatagggatgactgatgttgtttggtggtatgcactttgtttgtttttttttctttgtgtctgctgctttaatagatgctttgcaccactaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]