GGRNA | Results

検索語に色がつきます。重なると色が濃く表示されます。

Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. (288 bp)

LOCUS XM_024651321 288 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain-containing protein (SRAE_2000048500), partial mRNA. ACCESSION XM_024651321 VERSION XM_024651321.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This...

XM_024651321.1 - Strongyloides ratti - NCBI

Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. (2346 bp)

LOCUS XM_062931429 2346 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_15273), partial mRNA. ACCESSION XM_062931429 VERSION XM_062931429.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...

XM_062931429.1 - Colletotrichum destructivum - NCBI

Apiospora hydei protein argonaute (PG997_013705), partial mRNA. (3150 bp)

type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 3150 /locus_tag="PG997_013705" /db_xref="GeneID:92051079" CDS <1..3150 /locus_tag="PG997_013705" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="protein argonaute" /protein_id="XP_066663711.1" /db_xref="GeneID:92051079" /translation="...

XM_066818019.1 - Apiospora hydei - NCBI

Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. (2979 bp)

LOCUS XM_062919679 2979 bp mRNA linear PLN 07-FEB-2024 DEFINITION Colletotrichum destructivum Putative PAZ domain, Piwi domain, ribonuclease H-like superfamily, argonaute, linker 1 (CDEST_03520), partial mRNA. ACCESSION XM_062919679 VERSION XM_062919679.1 DBLINK BioProject: PRJNA1073607 BioSample: SAMN37882108 KEYWORDS RefSeq. SOURCE Colletotrichum destructivum ORGANISM Colletotrichum destructivum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae; Colletotrichum; Colletotrichum destructivum species complex. REFERENCE...

XM_062919679.1 - Colletotrichum destructivum - NCBI

Apiospora marii eukaryotic translation initiation factor 2c (PG985_013254), partial mRNA. (3111 bp)

mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3111 /locus_tag="PG985_013254" /db_xref="GeneID:92066081" CDS 1..3111 /locus_tag="PG985_013254" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="eukaryotic translation initiation factor 2c" /protein_id="XP_066677760.1" /db_xref="GeneID:92066081" /...

XM_066833020.1 - Apiospora marii - NCBI

Apiospora marii argonaute (PG985_005260), partial mRNA. (3114 bp)

marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3114 /locus_tag="PG985_005260" /db_xref="GeneID:92058090" CDS 1..3114 /locus_tag="PG985_005260" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; Piwi domain; Piwi domain profile." /codon_start=1 /product="argonaute" /protein_id="XP_066688189.1" /db_xref="GeneID:92058090" /translation="...

XM_066825029.1 - Apiospora marii - NCBI

Phytophthora ramorum Protein argonaute-4 (KRP23_1681), partial mRNA. (549 bp)

tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL" misc_feature 1..318 /locus_tag="KRP23_1681" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference...

XM_067886343.1 - Phytophthora ramorum (sudden oak death agent) - NCBI

Apiospora phragmitis uncharacterized protein (PG994_014412), partial mRNA. (3012 bp)

type_material="culture from type material of Arthrinium phragmitis" /db_xref="taxon:2905665" /chromosome="Unknown" gene 3012 /locus_tag="PG994_014412" /db_xref="GeneID:92098884" CDS 1..3012 /locus_tag="PG994_014412" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile.; Piwi_ago-like" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066708950.1" /db_xref="GeneID:92098884" /translation="...

XM_066865821.1 - Apiospora phragmitis - NCBI

Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. (903 bp)

LOCUS XM_024650915 903 bp mRNA linear INV 10-APR-2018 DEFINITION Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain-containing protein (SRAE_2000012500), partial mRNA. ACCESSION XM_024650915 VERSION XM_024650915.1 DBLINK BioProject: PRJNA304930 BioSample: SAMEA1682816 KEYWORDS RefSeq. SOURCE Strongyloides ratti ORGANISM Strongyloides ratti Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Tylenchina; Panagrolaimomorpha; Strongyloidoidea; Strongyloididae; Strongyloides. REFERENCE COMMENT...

XM_024650915.1 - Strongyloides ratti - NCBI

Strongyloides ratti Argonaute/Dicer protein, PAZ domain and Stem cell self-renewal protein Piwi domain and Ribonuclease H-like domain and Protein of unknown function DUF2650 family-containing protein (SRAE_2000036100), partial mRNA. (3513 bp)

misc_feature 1342..1638 /locus_tag="SRAE_2000036100" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1450..1452,1492..1494,1531..1533,1543..1545, 1594..1596,1615..1617,1621..1623) /locus_tag="SRAE_2000036100" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_...

XM_024651181.1 - Strongyloides ratti - NCBI

Apiospora aurea piwi domain-containing protein (PG986_006394), partial mRNA. (2925 bp)

aurea" /mol_type="mRNA" /strain="CBS 24483" /culture_collection="CBS:24483" /db_xref="taxon:335848" /chromosome="Unknown" gene 2925 /locus_tag="PG986_006394" /db_xref="GeneID:92075678" CDS 1..2925 /locus_tag="PG986_006394" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; N-terminal domain of argonaute; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="piwi domain-containing protein" /protein_id="XP_066702478.1" /db_xref="GeneID:92075678" /translation="...

XM_066842616.1 - Apiospora aurea - NCBI

Apiospora marii uncharacterized protein (PG985_001325), partial mRNA. (3165 bp)

Apiospora marii" /mol_type="mRNA" /strain="CBS 49790" /culture_collection="CBS:49790" /db_xref="taxon:335849" /chromosome="Unknown" gene 3165 /locus_tag="PG985_001325" /db_xref="GeneID:92054155" CDS 1..3165 /locus_tag="PG985_001325" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; PAZ domain; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066691973.1" /db_xref="GeneID:92054155" /translation="...

XM_066821094.1 - Apiospora marii - NCBI

Apiospora hydei uncharacterized protein (PG997_013034), partial mRNA. (1800 bp)

culture_collection="CBS:114990" /type_material="culture from type material of Arthrinium hydei" /db_xref="taxon:1337664" /chromosome="Unknown" gene 1800 /locus_tag="PG997_013034" /db_xref="GeneID:92050408" CDS 1..1800 /locus_tag="PG997_013034" /note="Argonaute linker 2 domain; consensus disorder prediction; PAZ domain; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="uncharacterized protein" /protein_id="XP_066663040.1" /db_xref="GeneID:92050408" /translation="...

XM_066817348.1 - Apiospora hydei - NCBI

PREDICTED: Channa argus argonaute RISC component 1 (ago1), transcript variant X3, mRNA. (4643 bp)

misc_feature 185..526 /gene="ago1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(320..322,365..367,407..409,419..421,473..475, 494..496,500..502) /gene="ago1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 659..1936 /gene="ago1" /note="PIWI...

XM_067511438.1 - Channa argus (northern snakehead) - NCBI

PREDICTED: Pongo abelii argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (18307 bp)

misc_feature 143..484 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(278..280,323..325,365..367,377..379,431..433, 452..454,458..460) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 617..1894 /gene="AGO3" /note="PIWI...

XM_054555331.2 - Pongo abelii (Sumatran orangutan) - NCBI

PREDICTED: Pongo abelii argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (20054 bp)

misc_feature 1890..2231 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(2025..2027,2070..2072,2112..2114,2124..2126, 2178..2180,2199..2201,2205..2207) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2364..3641 /gene="...

XM_054555322.2 - Pongo abelii (Sumatran orangutan) - NCBI

PREDICTED: Acropora muricata protein argonaute-2-like (LOC136922849), mRNA. (2966 bp)

misc_feature 508..642 /gene="LOC136922849" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 649..996 /gene="LOC136922849" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(796..798,841..843,886..888,898..900,952..954, 970..972,976..978) /gene="LOC136922849" /note...

XM_067191194.1 - Acropora muricata - NCBI

PREDICTED: Aotus nancymaae argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (11000 bp)

misc_feature 1690..2031 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1825..1827,1870..1872,1912..1914,1924..1926, 1978..1980,1999..2001,2005..2007) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 2164..3441 /gene="...

XM_012439828.2 - Aotus nancymaae (Ma's night monkey) - NCBI

PREDICTED: Capra hircus argonaute 3, RISC catalytic component (AGO3), transcript variant X4, mRNA. (15262 bp)

misc_feature 247..588 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(382..384,427..429,469..471,481..483,535..537, 556..558,562..564) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 721..1998 /gene="AGO3" /note="PIWI...

XM_018041542.1 - Capra hircus (goat) - NCBI

PREDICTED: Pan paniscus argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (27349 bp)

misc_feature 8723..9064 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(8858..8860,8903..8905,8945..8947,8957..8959, 9011..9013,9032..9034,9038..9040) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 9197..10474 /gene="...

XM_055095463.2 - Pan paniscus (pygmy chimpanzee) - NCBI

PREDICTED: Gorilla gorilla gorilla argonaute RISC catalytic component 3 (AGO3), transcript variant X5, mRNA. (13654 bp)

misc_feature 139..480 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(274..276,319..321,361..363,373..375,427..429, 448..450,454..456) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 613..1890 /gene="AGO3" /note="PIWI...

XM_063700437.1 - Gorilla gorilla gorilla (western lowland gorilla) - NCBI

PREDICTED: Pan paniscus argonaute RISC catalytic component 3 (AGO3), transcript variant X6, mRNA. (27843 bp)

misc_feature 9217..9558 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(9352..9354,9397..9399,9439..9441,9451..9453, 9505..9507,9526..9528,9532..9534) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 9691..10968 /gene="...

XM_034961271.3 - Pan paniscus (pygmy chimpanzee) - NCBI

PREDICTED: Capra hircus argonaute 3, RISC catalytic component (AGO3), transcript variant X3, mRNA. (15188 bp)

misc_feature <104..151 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 152..514 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(308..310,353..355,395..397,407..409,461..463, 482..484,488..490) /gene="AGO3" /note="nucleic acid-binding...

XM_018041535.1 - Capra hircus (goat) - NCBI

PREDICTED: Pongo abelii argonaute RISC component 1 (AGO1), transcript variant X5, mRNA. (12294 bp)

misc_feature 226..378 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 379..741 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(535..537,580..582,622..624,634..636,688..690, 709..711,715..717) /gene="AGO1" /note="nucleic acid-binding...

XM_054555298.2 - Pongo abelii (Sumatran orangutan) - NCBI

PREDICTED: Pan paniscus argonaute RISC catalytic component 3 (AGO3), transcript variant X4, mRNA. (29595 bp)

misc_feature 10969..11310 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(11104..11106,11149..11151,11191..11193,11203..11205, 11257..11259,11278..11280,11284..11286) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature...

XM_055095460.2 - Pan paniscus (pygmy chimpanzee) - NCBI

PREDICTED: Pan troglodytes argonaute RISC catalytic component 3 (AGO3), transcript variant X9, mRNA. (2728 bp)

misc_feature 128..469 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(263..265,308..310,350..352,362..364,416..418, 437..439,443..445) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 602..1879 /gene="AGO3" /note="PIWI...

XM_016959152.4 - Pan troglodytes (chimpanzee) - NCBI

PREDICTED: Amia calva protein argonaute-1 (LOC136763271), transcript variant X2, mRNA. (3235 bp)

misc_feature 277..429 /gene="LOC136763271" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 430..792 /gene="LOC136763271" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(586..588,631..633,673..675,685..687,739..741, 760..762,766..768) /gene="LOC136763271" /note...

XM_066717147.1 - Amia calva (bowfin) - NCBI

PREDICTED: Pan troglodytes argonaute RISC catalytic component 3 (AGO3), transcript variant X10, mRNA. (2826 bp)

misc_feature 226..567 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(361..363,406..408,448..450,460..462,514..516, 535..537,541..543) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 700..1977 /gene="AGO3" /note="PIWI...

XM_054665744.2 - Pan troglodytes (chimpanzee) - NCBI

PREDICTED: Pan paniscus argonaute RISC component 1 (AGO1), transcript variant X4, mRNA. (6981 bp)

misc_feature 228..380 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 381..743 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(537..539,582..584,624..626,636..638,690..692, 711..713,717..719) /gene="AGO1" /note="nucleic acid-binding...

XM_034961260.3 - Pan paniscus (pygmy chimpanzee) - NCBI

PREDICTED: Channa argus argonaute RISC component 4 (ago4), transcript variant X8, mRNA. (2821 bp)

misc_feature 307..696 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 727..879 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 880..1242 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_067496209.1 - Channa argus (northern snakehead) - NCBI

PREDICTED: Pongo abelii argonaute RISC component 1 (AGO1), transcript variant X4, mRNA. (12348 bp)

misc_feature 280..432 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 433..795 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(589..591,634..636,676..678,688..690,742..744, 763..765,769..771) /gene="AGO1" /note="nucleic acid-binding...

XM_054555295.2 - Pongo abelii (Sumatran orangutan) - NCBI

PREDICTED: Aotus nancymaae argonaute RISC component 1 (AGO1), transcript variant X3, mRNA. (12568 bp)

misc_feature 247..399 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 400..762 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(556..558,601..603,643..645,655..657,709..711, 730..732,736..738) /gene="AGO1" /note="nucleic acid-binding...

XM_012439801.2 - Aotus nancymaae (Ma's night monkey) - NCBI

PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (5471 bp)

misc_feature 276..665 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 696..848 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 849..1211 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_067612515.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI

PREDICTED: Pan paniscus argonaute RISC component 1 (AGO1), transcript variant X3, mRNA. (7270 bp)

misc_feature 517..669 /gene="AGO1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 670..1032 /gene="AGO1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(826..828,871..873,913..915,925..927,979..981, 1000..1002,1006..1008) /gene="AGO1" /note="nucleic acid-...

XM_034961257.3 - Pan paniscus (pygmy chimpanzee) - NCBI

PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X5, mRNA. (5480 bp)

XM_067612514.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI

PREDICTED: Clytia hemisphaerica protein argonaute-2-like (LOC136807415), mRNA. (3934 bp)

misc_feature 771..1001 /gene="LOC136807415" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 1029..1178 /gene="LOC136807415" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1179..1523 /gene="LOC136807415" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like;...

XM_067063999.1 - Clytia hemisphaerica - NCBI

PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X4, mRNA. (5503 bp)

misc_feature 275..664 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 695..847 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 848..1210 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_067612513.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI

PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X3, mRNA. (5512 bp)

XM_067612512.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI

PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X2, mRNA. (5519 bp)

XM_067612511.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI

PREDICTED: Chrysemys picta bellii argonaute RISC catalytic component 2 (AGO2), transcript variant X8, mRNA. (16719 bp)

misc_feature 269..631 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(425..427,470..472,512..514,524..526,578..580, 599..601,605..607) /gene="AGO2" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 764..2041 /gene="AGO2" /note="PIWI...

XM_065586283.1 - Chrysemys picta bellii (western painted turtle) - NCBI

PREDICTED: Thunnus thynnus argonaute RISC component 4 (ago4), transcript variant X1, mRNA. (5528 bp)

XM_067612510.1 - Thunnus thynnus (Atlantic bluefin tuna) - NCBI

PREDICTED: Osmerus mordax argonaute RISC component 4 (ago4), transcript variant X7, mRNA. (2970 bp)

misc_feature 334..486 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 487..867 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(661..663,706..708,748..750,760..762,814..816, 835..837,841..843) /gene="ago4" /note="nucleic acid-binding...

XM_067255313.1 - Osmerus mordax (rainbow smelt) - NCBI

PREDICTED: Symphalangus syndactylus protein argonaute-3 (LOC129468935), transcript variant X5, mRNA. (9521 bp)

misc_feature 188..529 /gene="LOC129468935" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(323..325,368..370,410..412,422..424,476..478, 497..499,503..505) /gene="LOC129468935" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 662..1939 /gene="...

XM_055254951.2 - Symphalangus syndactylus (siamang) - NCBI

Apiospora aurea protein argonaute (PG986_000207), partial mRNA. (3018 bp)

mol_type="mRNA" /strain="CBS 24483" /culture_collection="CBS:24483" /db_xref="taxon:335848" /chromosome="Unknown" gene 3018 /locus_tag="PG986_000207" /db_xref="GeneID:92069491" CDS 1..3018 /locus_tag="PG986_000207" /note="Argonaute linker 1 domain; Argonaute linker 2 domain; consensus disorder prediction; Mid domain of argonaute; N-terminal domain of argonaute; PAZ domain; PAZ domain profile.; PAZ_argonaute_like; Piwi domain; Piwi domain profile." /codon_start=1 /product="protein argonaute" /protein_id="XP_066705322.1" /db_xref="GeneID:92069491" /translation="...

XM_066836429.1 - Apiospora aurea - NCBI

PREDICTED: Eschrichtius robustus argonaute RISC catalytic component 3 (AGO3), transcript variant X3, mRNA. (4950 bp)

misc_feature 127..468 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(262..264,307..309,349..351,361..363,415..417, 436..438,442..444) /gene="AGO3" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 601..1878 /gene="AGO3" /note="PIWI...

XM_068539504.1 - Eschrichtius robustus (grey whale) - NCBI

PREDICTED: Pteronotus mesoamericanus argonaute RISC component 4 (AGO4), mRNA. (6326 bp)

misc_feature 143..532 /gene="AGO4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 563..715 /gene="AGO4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 716..1078 /gene="AGO4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_054571963.1 - Pteronotus mesoamericanus - NCBI

PREDICTED: Anas acuta argonaute RISC catalytic component 3 (AGO3), mRNA. (14078 bp)

misc_feature 406..690 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 718..870 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 871..1233 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_068657539.1 - Anas acuta (northern pintail) - NCBI

PREDICTED: Phalacrocorax carbo argonaute RISC catalytic component 3 (AGO3), mRNA. (6014 bp)

misc_feature 442..726 /gene="AGO3" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 754..906 /gene="AGO3" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 907..1269 /gene="AGO3" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_064471547.1 - Phalacrocorax carbo (great cormorant) - NCBI

PREDICTED: Anas acuta argonaute RISC catalytic component 2 (AGO2), mRNA. (13698 bp)

misc_feature 613..837 /gene="AGO2" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 865..1017 /gene="AGO2" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 1018..1380 /gene="AGO2" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_068672721.1 - Anas acuta (northern pintail) - NCBI

PREDICTED: Pseudorasbora parva argonaute RISC component 4 (ago4), transcript variant X6, mRNA. (3258 bp)

misc_feature 224..613 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 644..796 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 797..1159 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212"...

XM_067426678.1 - Pseudorasbora parva (stone moroko) - NCBI

Data Export:

Debug Info:

0.000 | 0.000 | search_start;
0.090 | 0.090 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))?to=0&format=json
0.108 | 0.018 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=0&format=json
0.279 | 0.170 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:Argonaute)%7C(nt:Argonaute)%7C(aa:Argonaute))%26((full_search:*:PAZ+domain)%7C(nt:PAZ+domain)%7C(aa:PAZ+domain))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.288 | 0.009 | cgi_end;

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]

Summary:

Results:

Data Export:

Debug Info: