GGRNA Home | Help | Advanced search

2024-04-20 12:25:58, GGRNA : RefSeq release 60 (20130726)

LOCUS       XM_003960843            1560 bp    mRNA    linear   PRI 30-OCT-2012
DEFINITION  PREDICTED: Homo sapiens double homeobox 4 like 7 (DUX4L7), mRNA.
ACCESSION   XM_003960843
VERSION     XM_003960843.1  GI:410173861
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004078508) annotated using gene prediction method: GNOMON.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: NCBI
            Annotation Status   :: Full annotation
            Annotation Version  :: Homo sapiens Annotation Release 104
            Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline
            Annotation Method   :: Best-placed RefSeq; Gnomon
            Features Annotated  :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1560
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Unknown"
                     /cell_line="CHM1htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..1560
                     /gene="DUX4L7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GNOMON. Supporting evidence
                     includes similarity to: 8 Proteins"
                     /db_xref="GeneID:653543"
                     /db_xref="HGNC:37266"
     CDS             1..1560
                     /gene="DUX4L7"
                     /codon_start=1
                     /transl_except=(pos:238..240,aa:OTHER)
                     /transl_except=(pos:898..900,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: double homeobox 4 like 7"
                     /protein_id="XP_003960892.1"
                     /db_xref="GI:410173862"
                     /db_xref="GeneID:653543"
                     /db_xref="HGNC:37266"
                     /translation="
MKWWSLPACGPLXKTRWLPVRVGLLAAPAAVHRPAEMHGIPPASLCPCPSKKFRPGLPVMALPTPSVSTLPVEAQGRGQXRRLVWTPSQSEALQACFQWNPYPGIATGEGLSLTINIPEPRVQIXVQNESSHQLRHHRWESRPWPGRHGPQEGRXKQTAVTGSQTTLLLRALEKDRFPGIIAKEELARETGVPESRSEIWIHNRRARHPGQAGWAPGQAGSLCNAAPRGCQPARSWVAFDHTGAWGKVLPAPHVTCVPGAHPQGAFMSHGARVVPVLQLSQAVPAEGISQPAPACGDFPXAAPAPPEGALSHPQAPRWPPHPGKSREDRDPQRDGLLGPCTVGHPGPAQVGPQGQGVLAPPASQGCPSWGWGWGPQVARAAWKPQAGASPPHQPAPPEDSVWQGQMQGIPATSQALQELGRSSALLSGQLLDELPASPEFLQQVQPFLEREAAGELEALEEAASLEAPLSEEEYRALLQDFRTRGLDGVRSGQGGGLSFAGKTWLAMEGHVFPPPSPLG
"
     misc_feature    241..411
                     /gene="DUX4L7"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(241..249,253..255,304..306,322..324,361..363,
                     367..372,379..384,388..396,400..405)
                     /gene="DUX4L7"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(241..243,250..252,370..372,379..384,391..393)
                     /gene="DUX4L7"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     misc_feature    460..624
                     /gene="DUX4L7"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(460..474,478..480,529..531,547..549,586..588,
                     592..597,604..609,613..621)
                     /gene="DUX4L7"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(466..468,475..477,595..597,604..609,616..618)
                     /gene="DUX4L7"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
ORIGIN      
atgaagtggtggagcctgcctgcctgtgggcctttanntaagacccgctggctgcctgtccgggtaggcctcctggctgcacctgccgcagtgcacaggccggctgagatgcacgggatcccaccggcctctctctgcccgtgtccgtccaagaaattccggccggggctccccgtgatggccctcccgacaccttctgtcagcaccctccccgtggaagcccagggacggggacagtgaaggagactcgtttggaccccgagccaaagcgaggccctgcaagcctgctttcagtggaacccgtacccgggcatcgccaccggagaagggctgtccctgaccatcaacattccagagcccagggtccagattncggttcagaatgagagttcacaccagctgaggcaccaccggtgggaatctcggccctggcctgggagacacggcccgcaagaaggcaggncaaaacagactgccgtcaccggatcccagaccaccctgctcctccgagcccttgagaaggatcgctttccaggcatcatcgccaaggaagagctggccagagagacgggcgtcccggagtcccggagtgagatctggattcacaatcgaagggccaggcacccaggacaggctggctgggcgcctgggcaggcaggcagcctgtgcaacgcggccccccgtggatgtcaacctgctcgctcgtgggtcgccttcgaccacaccggcgcgtggggaaaggtgcttcccgcaccccacgttacttgtgtgcctggggctcacccacagggggctttcatgagccatggagcgagggtggtccccgtgctccagctcagccaggcagtgcctgctgaggggatctcccaacctgccccggcatgcggggattttccctaagctgccccggctcctccggaaggggcactctcccatcctcaggctcctcggtggcctccgcacccgggcaaaagccgggaggacagggacccgcagcgcgacggcctgctgggcccttgcacggtgggacatcctgggcccgctcaagtggggccgcagggccaaggtgtgcttgcgccacccgcttcccaggggtgtccgtcgtggggctggggctggggtccccaggtcgccagggcggcatggaaaccccaagctggggcatctccacctcaccagccagcgcccccggaggactccgtgtggcaggggcagatgcaaggcatcccggcgacatcccaggcactccaggagctgggccggtcgtctgcactcctgtccggccagctgctggatgagctcccggcgagcccggagtttctgcagcaggtgcaacctttccttgaaagggaggccgcgggggagttggaggccttggaagaggccgcgtcgctggaagcacccctcagcgaggaagaataccgggctctgctacaggactttaggacgcgaggtttggacggggtcaggtcggggcagggaggtggcctctctttcgcggggaaaacctggctggctatggaggggcatgtcttccccccaccctctccactgggctga
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:653543 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:653543 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:653543 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:653543 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.