LOCUS       XM_003960835            1302 bp    mRNA    linear   PRI 30-OCT-2012
DEFINITION  PREDICTED: Homo sapiens Rhox homeobox family, member 2B (RHOXF2B),
            mRNA.
ACCESSION   XM_003960835
VERSION     XM_003960835.1  GI:410173843
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004078125) annotated using gene prediction method: GNOMON,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: NCBI
            Annotation Status   :: Full annotation
            Annotation Version  :: Homo sapiens Annotation Release 104
            Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline
            Annotation Method   :: Best-placed RefSeq; Gnomon
            Features Annotated  :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1302
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /cell_line="CHM1htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..1302
                     /gene="RHOXF2B"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GNOMON. Supporting evidence
                     includes similarity to: 11 ESTs, 3 Proteins"
                     /db_xref="GeneID:727940"
                     /db_xref="HGNC:33519"
     variation       complement(52)
                     /gene="RHOXF2B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3810752"
     misc_feature    76..78
                     /gene="RHOXF2B"
                     /note="upstream in-frame stop codon"
     variation       complement(109)
                     /gene="RHOXF2B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113051913"
     CDS             154..1302
                     /gene="RHOXF2B"
                     /codon_start=1
                     /product="rhox homeobox family member 2B"
                     /protein_id="XP_003960884.1"
                     /db_xref="GI:410173844"
                     /db_xref="GeneID:727940"
                     /db_xref="HGNC:33519"
                     /translation="

MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELECIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPASDPKSTRRNSDQEPEDPSAESAETHGFVDHAPRWRSSPDPATKTPATSAWVSCSMSSRKKTVSACLGTRTDAKDIETSVTEAGGDDEKKIRTKPEQGAGAGKESHVYAGAADPMIHENQKGGGGHQEPWQQQPEELAQDSSAEDPQPQDQERLFSPSTFGGLHLKELDSIF

"
     misc_feature    574..732
                     /gene="RHOXF2B"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(574..576,625..627,643..645,682..684,688..693,
                     700..705,709..717,721..726)
                     /gene="RHOXF2B"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(691..693,700..705,712..714)
                     /gene="RHOXF2B"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       complement(403)
                     /gene="RHOXF2B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199654934"
     variation       complement(430)
                     /gene="RHOXF2B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375698805"
     variation       complement(444)
                     /gene="RHOXF2B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377626082"
     variation       complement(454)
                     /gene="RHOXF2B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202022237"
     variation       complement(468)
                     /gene="RHOXF2B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373851720"
     variation       complement(679)
                     /gene="RHOXF2B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201815129"
     variation       complement(943)
                     /gene="RHOXF2B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16995714"
     variation       complement(1056)
                     /gene="RHOXF2B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17327277"
     variation       complement(1165..1166)
                     /gene="RHOXF2B"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34238633"
     variation       complement(1215)
                     /gene="RHOXF2B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141922356"
ORIGIN      

aggaggtctctaagtggatacactgttgctgagtctagacaccagaagaacgttgcaggcggcgactcacagttctagcactgcctaggagagcgtggtggccccagctcagaatctgcagaagtgcacagctccatccacaccactcagggtatggagcctccggaccagtgtagccagtatatgaccagcttgctcagccctgcagtcgacgacgagaaagaactacaggatatgaatgctatggtgctgtcgcttactgaagaggtcaaagaggaggaagaggatgcacagcctgagcctgagcaaggcacagcagcaggagaaaagttaaagtcggcaggagcccaaggcggagaagaaaaagatggcggcggagaagaaaaagatggcggcggcgccggagttcctggccacctatgggaaggagacctcgagggcaccagcggcagcgatggcaacgttgaggacagcgaccagagcgagaaggaacctgggcagcagtattcgcgcccacagggcgccgtcggggggctggagcctggcaacgcgcagcagcccaacgtccacgccttcaccccattgcagctgcaggagctggagtgcattttccaacgcgagcagttccccagtgagttcctgcgaaggaggctggcaagaagcatgaatgtgactgaactcgcagtgcagatttggtttgagaatagaagagccaaatggaggagacatcagagggcattaatggcaagaaacatgctgcccttcatggcagtgggccagcctgcgtccgacccgaagtccacgcgccggaactcggaccaggagccagaggaccccagcgcagaatccgcggagacgcacggcttcgtcgaccacgctcccaggtggcgttccagcccagatccggccacgaagacaccggcgacctcggcctgggtttcctgttcgatgagctccagaaagaagacggtcagtgcctgtctggggacccgaaccgatgcgaaggatatagagacttcagtgactgaagctggaggagacgatgagaagaaaatacggaccaaacccgagcagggagcaggagcaggaaaagaaagtcacgtgtacgcgggagctgcggaccccatgatccacgagaaccagaagggcggtggtggccaccaggagccctggcagcagcagcctgaggagttggcccaggactcctccgctgaggatccgcaaccccaagatcaggagcgtctattcagccccagcacgttcggcgggttgcacctgaaggagctagacagcattttctga

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:727940 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:727940 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
            GeneID:727940 -> Cellular component: GO:0005634 [nucleus] evidence: IEA