GGRNA Home | Help | Advanced search

2019-03-26 15:52:58, GGRNA : RefSeq release 60 (20130726)

LOCUS       XM_003960306            4163 bp    mRNA    linear   PRI 30-OCT-2012
DEFINITION  PREDICTED: Homo sapiens ankyrin repeat domain 36B (ANKRD36B), mRNA.
ACCESSION   XM_003960306
VERSION     XM_003960306.1  GI:410171723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004078008) annotated using gene prediction method: GNOMON,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: NCBI
            Annotation Status   :: Full annotation
            Annotation Version  :: Homo sapiens Annotation Release 104
            Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline
            Annotation Method   :: Best-placed RefSeq; Gnomon
            Features Annotated  :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4163
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /cell_line="CHM1htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..4163
                     /gene="ANKRD36B"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GNOMON. Supporting evidence
                     includes similarity to: 4 mRNAs, 14 ESTs, 4 Proteins"
                     /db_xref="GeneID:57730"
                     /db_xref="HGNC:29333"
     variation       389
                     /gene="ANKRD36B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3896685"
     variation       416
                     /gene="ANKRD36B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1814505"
     variation       420
                     /gene="ANKRD36B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1814506"
     misc_feature    486..488
                     /gene="ANKRD36B"
                     /note="upstream in-frame stop codon"
     variation       521
                     /gene="ANKRD36B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1868445"
     CDS             561..4163
                     /gene="ANKRD36B"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: ankyrin repeat
                     domain-containing protein 36B"
                     /protein_id="XP_003960355.1"
                     /db_xref="GI:410171724"
                     /db_xref="GeneID:57730"
                     /db_xref="HGNC:29333"
                     /translation="
MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGRTALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNAIDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVIFDLIYEYKRKRYEDLPINSNPVSPQKQRAEKATSDDKDSVSNIATEIKEGPISGTVSSQKQPAEKATSDEKDSVSNIATEIKEGQQSGTVSPQKQSAQKVIFKKKVSLLNIATRIMGGGKSGTVSSQKQPASKTASDKTDSALNTATEIKDGLQCGTVSSQKQQALKATTDEEGSVSNIATEIKDGEKSGTVSSQKKPALKATSDEKDSFSNITREKKDGEISRTVSSQKPPALKATSVKEDSVLNIARGKKDGEKSRTVSFEQPPGLKATRDEKDSLLNIARGKKDGEKTRRVSSHKQPSLKATSDKEDSVPNMATETKDEQISGTVSCQKQPALKATSDKKDSVSNIPTEIKDGQQSGTVSSQKQPAWKATSVKKDSVSNIATEIKDGQIRGTVSSQRRPALKTTGDEKDSVSNIAREIKDGEKSGTVSPQKQSAQKVIFKKKVSLLNIATRITGGGKSGTEYPENLRTLKATIENKDSVLNTATKMKEVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDIIQSSQTVSEDGDSLCCNCKNVILLIDQHEMKCKDCVHLLKIKNXXXXXXXXXFAMQQEKKKRRNVEELHQKVREKLRITKEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQISETDEKEDLLHENRLMQDEIAWLRLEKDTIRNQNLENKYLKDFEIVKRKREDLQKALKRNGETLAKMIACYSGQLAALTDENTTLHSKLEKQRESRQRLETEMQSCGCRLNAALCDHDQSHSSERDQELAFQGTVDKWCHLQENLNFCILILSLQLSKAESKSRVLETELHYTREALKEKALVFEHVQSELKQKQSRVKDTEKMYKSGYSTMEKCIEKQERFCQXKQNMLLQQQLDDARNKADNQEKAILNIQARCDARVQNLQAECRKHRLLLEEDNKMLVNELNHSKEKECQYEKEKAEREVSIKKNKYFSNFLK
"
     misc_feature    630..779
                     /gene="ANKRD36B"
                     /note="Ankyrin repeats (many copies); Region: Ank_4;
                     pfam13637"
                     /db_xref="CDD:205814"
     misc_feature    699..1076
                     /gene="ANKRD36B"
                     /note="ankyrin repeats;  ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:29261"
     misc_feature    729..995
                     /gene="ANKRD36B"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:205076"
     misc_feature    897..1271
                     /gene="ANKRD36B"
                     /note="ankyrin repeats;  ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:29261"
     misc_feature    927..1205
                     /gene="ANKRD36B"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:205076"
     variation       2111
                     /gene="ANKRD36B"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35495417"
     variation       2117..2118
                     /gene="ANKRD36B"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:374690968"
ORIGIN      
gataccgtcctcccgcctcgcacccatcagcgcggaccccgggggcgacgcagtggcgatgtcgggctgtgggcccagcggtggcactaggcggagaagcaccactcaaccccatccctgggctgcagagggcccagcgcggggggctccgagcgtcgggagcctgtggaagagaagagcgcgcgggcgacagttaaacaggccctggggcagggcgcgcctcgcgctccagggagccccgccctcccgcggcacctccgcagcaaccgccgcctgcactgggcgcgcgagagctgctagggcggtttctctgcctcgggcctgttgggcagggccggctaaggtgcgcgtgctcgctggttctaacccttctgttgggcgtttctgcggagaggcgggaggcgctgagagtctgcgcggaggtccgtgcacagactgctttgcctgttgttgctcttcggaggcggcgatccccgaaggcgagctgaaatacggctgcaggctacaatttgcagccgacgattaaggaagacgacgagcgggagaggtggcccaccctcatggagcgcttgtgctcggatggcttcgcatttccccattactacattaaaccgtatcatctgaagaggatccacagagctgtcttacgtggtaatctggagaaactgaagtaccttctgctcacgtattatgacgccaataagagagacaggaaggaaaggactgccctacatttggcctgtgccactggccaaccggaaatggtacatctcctggtgtccagaagatgtgagcttaacctctgcgaccgtgaagacaggacacctctgatcaaggctgtacaactgaggcaggaggcttgtgcaactcttctgctgcaaaatggcgccgatccaaatattacggatgtctttggaaggactgctctgcactacgctgtgtataatgaagatacatccatgatagaaaaacttctttcacatggtacaaatattgaagaatgcagcaagaatgaatatcagccactgttacttgctgtgagtcgaagaaaagtgaaaatggtggaatttttattaaagaaaaaagcaaatgtaaatgccattgattatcttggcagatcagccctcatacttgctgttactcttggagaaaaagatatagtcattcttcttctgcagcacaatattgatgtgttttctcgagatgtgtatggaaagcttgcagaagattatgccagtgaggctgagaatagagtcatttttgatctaatttatgaatacaaaagaaagagatatgaagatcttcctataaatagcaatccagtgtctcctcagaaacaacgagctgagaaggctacaagtgacgacaaagattctgtttcaaatatagccacagaaataaaggagggacctatatctgggacagtgtcttctcagaaacaaccagctgagaaggctacaagtgacgagaaagattctgtttcaaatatagccacagaaataaaggagggacaacaatctgggacagtgtctcctcagaaacaatcggcccagaaggttatatttaaaaagaaagtttctcttttgaatattgccacaagaataatgggcggtgggaaatctggaacagtgtcttctcagaaacaaccagcctcaaagactgcaagtgacaagacagattctgctttgaatacagctacagaaataaaggatggactacaatgtgggacagtgtcttctcagaaacaacaagccttgaaggctacaactgacgaggaaggttctgtttctaatatagccacagaaataaaggatggagaaaaatctgggacagtgtcttctcagaaaaaaccagccttgaaggccacaagtgatgagaaagattctttttcgaatataaccagagaaaaaaaggatggagaaatatctaggacagtgtcttctcagaaaccaccagccttgaaggctacaagtgtcaaggaagattctgttttgaatatagccagaggaaaaaaggatggagaaaaatctaggacagtgtcttttgagcaaccaccaggcttgaaggctacaagagacgagaaagattctcttttgaatatagccagaggaaaaaaagatggagaaaaaactaggagagtgtcttctcataaacaaccatccttgaaggctacaagtgacaaggaagattctgttccgaatatggccacagaaacaaaggatgaacaaatatctgggacagtgtcttgtcagaaacaaccagccttgaaggctacaagtgacaagaaagattctgtttcgaatatacccacagaaataaaggatggacaacaatctggaacagtgtcttctcagaaacaaccggcctggaaggctacaagtgtcaagaaagattctgtttcgaatatagccacagaaataaaggatggacaaatacgtgggacagtgtcttctcagagacgaccagccttgaagactacaggtgatgagaaagattctgtttcgaatatagccagagaaataaaggatggagaaaaatctgggacagtgtctcctcagaaacaatcggcccagaaggttatatttaaaaagaaagtttctcttttgaatattgccacaagaataacgggcggtgggaaatctggaacagagtatcctgagaatctgcgcaccttgaaggctacaattgaaaataaagattctgttctgaatacagccaccaaaatgaaggaggtacaaacatccacaccagcagaacaagacttagaaatggcatcagagggagagcaaaagaggcttgaagaatatgaaaataaccagccacaggtgaaaaaccaaatacattctagggatgaccttgatgacataattcagtcatctcaaacagtctcagaggacggtgactcgctttgctgtaattgtaagaatgtcatattactcattgatcaacatgaaatgaagtgtaaagattgtgttcacctattgaaaattaaaaatannnnnnnnnnnnnnnnnnnnnnnnnatttgccatgcagcaagaaaaaaagaaaagaagaaatgttgaagagttgcaccaaaaagttagggaaaagttaagaataacaaaagagcaatataggatagaagctgatgtgacaaaaccaattaaaccggctctcaaatcagcagaggtggaattgaagacaggaggaaataattcaaatcagatttctgaaactgatgaaaaagaagacctgctgcatgaaaaccgcttgatgcaagatgaaattgcctggctcaggctggaaaaagacacaataagaaaccaaaacctggaaaataaatacttaaaagactttgaaattgtgaaaagaaagcgtgaagaccttcaaaaggctctaaaacggaatggggaaacattagcaaaaatgatagcctgttatagtggacagcttgctgctctgacagatgaaaacacaacgctgcattccaaactggagaagcaaagagagagcaggcaaagactggaaacagaaatgcaatcatgtggttgtagactgaatgctgctctatgtgatcatgatcaaagtcattcatcagaaagagatcaagagcttgctttccagggcacagtagataaatggtgtcatttacaggaaaatttgaatttttgtattctgattctttctctgcaactttccaaagctgagagtaagtccagagtcctcgaaactgagctccattacacaagagaggctctgaaagaaaaggctttggtttttgaacacgtgcaaagtgagctaaagcaaaaacagagtcgagtgaaggacactgaaaaaatgtacaaaagtggatacagtacaatggaaaaatgcatagaaaagcaggaaagattttgtcaanctaaacaaaatatgttgcttcaacagcaactggatgatgctcgcaacaaagctgacaatcaagaaaaagcaatacttaatattcaagccagatgtgatgctagagtacaaaaccttcaagctgagtgcagaaagcaccgtcttttactagaagaagacaataaaatgttggtcaatgaactgaatcattcgaaagaaaaagaatgccaatatgaaaaagagaaagcagaaagagaagtaagtatcaagaaaaataagtatttttcaaacttcctgaagtaa
//

Annotations:



by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.